Preliminary DNA Data Windermere Creek, BC Columbia Basin Water Quality Monitoring Project - Windermere Creek
Download: lwa_lk-windermere-ambassadors_report_preliminarydnadatawindermerecreek_2019.pdf
Data and information included in this report is a first and preliminary examination of results from Windermere Creek (BC), which consists of a list of the macroinvertebrate taxa detected within the samples submitted. This report aims to highlight the different macroinvertebrate EPT taxa and provide basic richness metrics as a useful contribution for community groups to assess river health.
Resource metadata
Field | Value |
Data last updated | November 23, 2021 |
Metadata last updated | May 12, 2022 |
Created | November 23, 2021 |
Format | |
License | CC-BY-SA-4.0 |
Data collection info | n/a |
Data processing | n/a |
Data type | non-lab |
Has views | True |
Hash | 5a1afd2f11385df53ebcddc0131d43f9 |
Id | 04d7f4c8-f731-4980-aa59-8c8a1a0db5bf |
Load status | Invalid header row: |
Mimetype | application/pdf |
On same domain | True |
Package id | 626ba05e-057d-458f-9435-3ae0aa0f94d8 |
Position | 11 |
Resource citation | Lake Windermere Ambassadors. (2019). Preliminary DNA Data Windermere Creek, BC Columbia Basin Water Quality Monitoring Project - Windermere Creek. Prepared for WWF Canada, Environment and Climate Change Canada, Living Lakes Canada. Columbia Basin Water Hub [Resource]. Invermere. https://doi.org/10.48511/KBGB-DJ25 |
Resource data disclaimer | No warranty or guarantee exists that the information is accurate, complete, current, or suitable for any purpose. The individual user must confirm the accuracy of the data and whether it will be appropriate for their purpose. |
Resource location | Windermere Creek |
Size | 398.4 KiB |
State | active |
Url type | upload |
Waterhub certified | Certified |
Waterhub grade | People and Perspectives |
upload | |
Citation (Required) | Lake Windermere Ambassadors. (2019). Preliminary DNA Data Windermere Creek, BC Columbia Basin Water Quality Monitoring Project - Windermere Creek. Prepared for WWF Canada, Environment and Climate Change Canada, Living Lakes Canada. Columbia Basin Water Hub [Resource]. Invermere. https://doi.org/10.48511/KBGB-DJ25 |
Resource Location | Windermere Creek |
Data Collection Information | n/a |
Data Processing | n/a |
Data Disclaimer | No warranty or guarantee exists that the information is accurate, complete, current, or suitable for any purpose. The individual user must confirm the accuracy of the data and whether it will be appropriate for their purpose. |
Water Hub Data Grade | People and Perspectives |
Date of Most Recent Water Hub QA/QC | |
Loading Status | Invalid header row: |
Datastore Status | |
Data type | General |
Site
No data available
Parameter
No data available