Changes
On May 12, 2022 at 2:51:20 PM UTC, verenashaw-6471:
-
Added field
datastore_status
to resource Preliminary DNA Data Windermere Creek, BC Columbia Basin Water Quality Monitoring Project - Windermere Creek in Lake Windermere Ambassadors Annual Water Monitoring Reports -
Changed value of field
resource_citation
of resource Preliminary DNA Data Windermere Creek, BC Columbia Basin Water Quality Monitoring Project - Windermere Creek toLake Windermere Ambassadors. (2019). Preliminary DNA Data Windermere Creek, BC Columbia Basin Water Quality Monitoring Project - Windermere Creek. Prepared for WWF Canada, Environment and Climate Change Canada, Living Lakes Canada. Columbia Basin Water Hub [Resource]. Invermere. https://doi.org/10.48511/KBGB-DJ25
(previouslyLake Windermere Ambassadors (2019). Preliminary DNA Data Windermere Creek, BC Columbia Basin Water Quality Monitoring Project - Windermere Creek. Prepared for WWF Canada, Environment and Climate Change Canada, Living Lakes Canada. Columbia Basin Water Hub (Resource). Invermere. (DOI)
) in Lake Windermere Ambassadors Annual Water Monitoring Reports -
Changed value of field
waterhub_grade
of resource Preliminary DNA Data Windermere Creek, BC Columbia Basin Water Quality Monitoring Project - Windermere Creek toPeople and Perspectives
(previouslyNot Reviewed
) in Lake Windermere Ambassadors Annual Water Monitoring Reports
f | 1 | { | f | 1 | { |
2 | "author": null, | 2 | "author": null, | ||
3 | "author_email": null, | 3 | "author_email": null, | ||
4 | "citation": "Lake Windermere Ambassadors. (2021). Lake Windermere | 4 | "citation": "Lake Windermere Ambassadors. (2021). Lake Windermere | ||
5 | Ambassadors Annual Water Monitoring Reports [Data set]. Columbia Basin | 5 | Ambassadors Annual Water Monitoring Reports [Data set]. Columbia Basin | ||
6 | Water Hub. https://doi.org/10.48511/KBGB-DJ25", | 6 | Water Hub. https://doi.org/10.48511/KBGB-DJ25", | ||
7 | "creator": "Lake Windermere Ambassadors", | 7 | "creator": "Lake Windermere Ambassadors", | ||
8 | "creator_user_id": "efbb05c2-ed3c-42ec-894b-cafbb9d5f2db", | 8 | "creator_user_id": "efbb05c2-ed3c-42ec-894b-cafbb9d5f2db", | ||
9 | "data_disclaimer": "No warranty or guarantee exists that the | 9 | "data_disclaimer": "No warranty or guarantee exists that the | ||
10 | information is accurate, complete, current, or suitable for any | 10 | information is accurate, complete, current, or suitable for any | ||
11 | purpose. The individual user must confirm the accuracy of the data and | 11 | purpose. The individual user must confirm the accuracy of the data and | ||
12 | whether it will be appropriate for their purpose.", | 12 | whether it will be appropriate for their purpose.", | ||
13 | "data_type": "Lake", | 13 | "data_type": "Lake", | ||
14 | "end_date": "2020-12-31", | 14 | "end_date": "2020-12-31", | ||
15 | "funding_reference": "See individual reporots for funding | 15 | "funding_reference": "See individual reporots for funding | ||
16 | description.", | 16 | description.", | ||
17 | "groups": [ | 17 | "groups": [ | ||
18 | { | 18 | { | ||
19 | "description": "This group includes all the datasets which fall | 19 | "description": "This group includes all the datasets which fall | ||
20 | within the Columbia-Kootenay Headwaters Hydrologic region ", | 20 | within the Columbia-Kootenay Headwaters Hydrologic region ", | ||
21 | "display_name": "Columbia-Kootenay Headwaters", | 21 | "display_name": "Columbia-Kootenay Headwaters", | ||
22 | "id": "20673d8f-8f40-4e64-9f34-4966d5123705", | 22 | "id": "20673d8f-8f40-4e64-9f34-4966d5123705", | ||
23 | "image_display_url": | 23 | "image_display_url": | ||
24 | rhub.ca/uploads/group/2021-03-02-214610.209659Mapfinalheadwayers.png", | 24 | rhub.ca/uploads/group/2021-03-02-214610.209659Mapfinalheadwayers.png", | ||
25 | "name": "columbia-kootenay-headwaters", | 25 | "name": "columbia-kootenay-headwaters", | ||
26 | "title": "Columbia-Kootenay Headwaters" | 26 | "title": "Columbia-Kootenay Headwaters" | ||
27 | } | 27 | } | ||
28 | ], | 28 | ], | ||
29 | "id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 29 | "id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
30 | "identifier": "10.48511/KBGB-DJ25", | 30 | "identifier": "10.48511/KBGB-DJ25", | ||
31 | "isopen": false, | 31 | "isopen": false, | ||
32 | "keywords": "Community-based | 32 | "keywords": "Community-based | ||
33 | monitoring,Hydrology,Hydrometric,Fish,Lake,People and | 33 | monitoring,Hydrology,Hydrometric,Fish,Lake,People and | ||
34 | Perspectives,Water Quality,Stream,Water temperature,Sediment | 34 | Perspectives,Water Quality,Stream,Water temperature,Sediment | ||
35 | Analysis,Bacteriological,CABIN", | 35 | Analysis,Bacteriological,CABIN", | ||
36 | "latitude": "50.472805", | 36 | "latitude": "50.472805", | ||
37 | "license_id": "CC-BY-SA-4.0", | 37 | "license_id": "CC-BY-SA-4.0", | ||
38 | "license_title": "CC-BY-SA-4.0", | 38 | "license_title": "CC-BY-SA-4.0", | ||
39 | "location": "Lake Windermere, Windermere Creek", | 39 | "location": "Lake Windermere, Windermere Creek", | ||
40 | "longitude": "-116.019217", | 40 | "longitude": "-116.019217", | ||
41 | "maintainer": null, | 41 | "maintainer": null, | ||
42 | "maintainer_email": "cbwaterhub@livinglakescanada.ca", | 42 | "maintainer_email": "cbwaterhub@livinglakescanada.ca", | ||
43 | "metadata_created": "2021-11-23T21:03:29.640876", | 43 | "metadata_created": "2021-11-23T21:03:29.640876", | ||
n | 44 | "metadata_modified": "2022-05-12T14:36:53.408612", | n | 44 | "metadata_modified": "2022-05-12T14:51:20.531352", |
45 | "name": | 45 | "name": | ||
46 | "lake-windermere-ambassadors-annual-water-monitoring-reports", | 46 | "lake-windermere-ambassadors-annual-water-monitoring-reports", | ||
47 | "notes": "Included are the annual water monitoring reports from Lake | 47 | "notes": "Included are the annual water monitoring reports from Lake | ||
48 | Windermere and Windermere Creek as well as aquatic invasive plant | 48 | Windermere and Windermere Creek as well as aquatic invasive plant | ||
49 | reports and a report on Lake Windermere water birds.", | 49 | reports and a report on Lake Windermere water birds.", | ||
50 | "num_resources": 18, | 50 | "num_resources": 18, | ||
51 | "num_tags": 12, | 51 | "num_tags": 12, | ||
52 | "organization": { | 52 | "organization": { | ||
53 | "approval_status": "approved", | 53 | "approval_status": "approved", | ||
54 | "created": "2021-05-20T09:58:43.376117", | 54 | "created": "2021-05-20T09:58:43.376117", | ||
55 | "description": "The Lake Windermere Ambassadors are a | 55 | "description": "The Lake Windermere Ambassadors are a | ||
56 | community-based environmental stewardship non-profit working in the | 56 | community-based environmental stewardship non-profit working in the | ||
57 | East Kootenay region of BC. The Ambassadors have a vision of an | 57 | East Kootenay region of BC. The Ambassadors have a vision of an | ||
58 | ecologically healthy Lake Windermere with balanced management | 58 | ecologically healthy Lake Windermere with balanced management | ||
59 | approaches that support recreation and traditional uses, high fish and | 59 | approaches that support recreation and traditional uses, high fish and | ||
60 | wildlife values, and economic prosperity in the region.", | 60 | wildlife values, and economic prosperity in the region.", | ||
61 | "id": "fa6d1422-26e0-4d81-9abc-94f8fb043e7c", | 61 | "id": "fa6d1422-26e0-4d81-9abc-94f8fb043e7c", | ||
62 | "image_url": "2021-05-20-174743.524491Master-Large.png", | 62 | "image_url": "2021-05-20-174743.524491Master-Large.png", | ||
63 | "is_organization": true, | 63 | "is_organization": true, | ||
64 | "name": "lake-windermere", | 64 | "name": "lake-windermere", | ||
65 | "state": "active", | 65 | "state": "active", | ||
66 | "title": "Lake Windermere Ambassadors", | 66 | "title": "Lake Windermere Ambassadors", | ||
67 | "type": "organization" | 67 | "type": "organization" | ||
68 | }, | 68 | }, | ||
69 | "other_sources": "n/a", | 69 | "other_sources": "n/a", | ||
70 | "owner_org": "fa6d1422-26e0-4d81-9abc-94f8fb043e7c", | 70 | "owner_org": "fa6d1422-26e0-4d81-9abc-94f8fb043e7c", | ||
71 | "private": false, | 71 | "private": false, | ||
72 | "publication_year": "2021", | 72 | "publication_year": "2021", | ||
73 | "relationships_as_object": [], | 73 | "relationships_as_object": [], | ||
74 | "relationships_as_subject": [], | 74 | "relationships_as_subject": [], | ||
75 | "resources": [ | 75 | "resources": [ | ||
76 | { | 76 | { | ||
77 | "cache_last_updated": null, | 77 | "cache_last_updated": null, | ||
78 | "cache_url": null, | 78 | "cache_url": null, | ||
79 | "created": "2021-11-23T21:14:26.266170", | 79 | "created": "2021-11-23T21:14:26.266170", | ||
80 | "data_collection_info": "N/A", | 80 | "data_collection_info": "N/A", | ||
81 | "data_processing": "N/A", | 81 | "data_processing": "N/A", | ||
82 | "datastore_active": false, | 82 | "datastore_active": false, | ||
83 | "datastore_status": "", | 83 | "datastore_status": "", | ||
84 | "description": "In 2020, the Lake Windermere Ambassadors | 84 | "description": "In 2020, the Lake Windermere Ambassadors | ||
85 | collected physical and chemical water quality parameters at three | 85 | collected physical and chemical water quality parameters at three | ||
86 | sample sites on Lake Windermere once weekly during the summer, from | 86 | sample sites on Lake Windermere once weekly during the summer, from | ||
87 | late May to September\u200b. The lake sampling regime included water | 87 | late May to September\u200b. The lake sampling regime included water | ||
88 | temperature, turbidity/clarity, pH, conductivity, depth, and dissolved | 88 | temperature, turbidity/clarity, pH, conductivity, depth, and dissolved | ||
89 | oxygen. Once monthly from May to September we collected Total | 89 | oxygen. Once monthly from May to September we collected Total | ||
90 | Dissolved Phosphorus and Total Phosphorous. The LWA monitored | 90 | Dissolved Phosphorus and Total Phosphorous. The LWA monitored | ||
91 | substrate samplers at six sites on the east side of Lake Windermere | 91 | substrate samplers at six sites on the east side of Lake Windermere | ||
92 | for invasive mussels, and monitored tributary flows and water quality | 92 | for invasive mussels, and monitored tributary flows and water quality | ||
93 | at the outlet of Windermere Creek and Abel Creek. \u200bE. coli data | 93 | at the outlet of Windermere Creek and Abel Creek. \u200bE. coli data | ||
94 | was collected at public swim beaches weekly, from May until September, | 94 | was collected at public swim beaches weekly, from May until September, | ||
95 | excluding weeks with a statutory holiday Monday, in partnership with | 95 | excluding weeks with a statutory holiday Monday, in partnership with | ||
96 | the Interior Health Authority.", | 96 | the Interior Health Authority.", | ||
97 | "format": "PDF", | 97 | "format": "PDF", | ||
98 | "hash": "e7a7c3e18b245292c6e847bb9235bbac", | 98 | "hash": "e7a7c3e18b245292c6e847bb9235bbac", | ||
99 | "header_row": "", | 99 | "header_row": "", | ||
100 | "id": "1e59877d-72a2-4fed-bd21-9d613c0e53a5", | 100 | "id": "1e59877d-72a2-4fed-bd21-9d613c0e53a5", | ||
101 | "last_modified": "2021-11-23T21:14:26.212715", | 101 | "last_modified": "2021-11-23T21:14:26.212715", | ||
102 | "load_status": "", | 102 | "load_status": "", | ||
103 | "metadata_modified": "2022-05-12T14:36:53.412360", | 103 | "metadata_modified": "2022-05-12T14:36:53.412360", | ||
104 | "mimetype": "application/pdf", | 104 | "mimetype": "application/pdf", | ||
105 | "mimetype_inner": null, | 105 | "mimetype_inner": null, | ||
106 | "name": "Water Quality Monitoring Program 2020 Final Report", | 106 | "name": "Water Quality Monitoring Program 2020 Final Report", | ||
107 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 107 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
108 | "position": 0, | 108 | "position": 0, | ||
109 | "resource_citation": "Peck, G. (2021). Lake Windermere Community | 109 | "resource_citation": "Peck, G. (2021). Lake Windermere Community | ||
110 | Based Water Quality Monitoring Program 2020 Final Report. Prepared for | 110 | Based Water Quality Monitoring Program 2020 Final Report. Prepared for | ||
111 | Lake Windermere Ambassadors. Columbia Basin Water Hub. [Resource]. | 111 | Lake Windermere Ambassadors. Columbia Basin Water Hub. [Resource]. | ||
112 | Invermere. https://doi.org/10.48511/KBGB-DJ25", | 112 | Invermere. https://doi.org/10.48511/KBGB-DJ25", | ||
113 | "resource_data_disclaimer": "No warranty or guarantee exists | 113 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
114 | that the information is accurate, complete, current, or suitable for | 114 | that the information is accurate, complete, current, or suitable for | ||
115 | any purpose. The individual user must confirm the accuracy of the data | 115 | any purpose. The individual user must confirm the accuracy of the data | ||
116 | and whether it will be appropriate for their purpose.", | 116 | and whether it will be appropriate for their purpose.", | ||
117 | "resource_location": "Lake Windermere", | 117 | "resource_location": "Lake Windermere", | ||
118 | "resource_type": null, | 118 | "resource_type": null, | ||
119 | "size": 1595807, | 119 | "size": 1595807, | ||
120 | "state": "active", | 120 | "state": "active", | ||
121 | "url": | 121 | "url": | ||
122 | d/lwa_peck_report_lkwindermerewaterqualitymonitoringprogram_2020.pdf", | 122 | d/lwa_peck_report_lkwindermerewaterqualitymonitoringprogram_2020.pdf", | ||
123 | "url_type": "upload", | 123 | "url_type": "upload", | ||
124 | "waterhub_certified": "Certified", | 124 | "waterhub_certified": "Certified", | ||
125 | "waterhub_grade": "People and Perspectives" | 125 | "waterhub_grade": "People and Perspectives" | ||
126 | }, | 126 | }, | ||
127 | { | 127 | { | ||
128 | "cache_last_updated": null, | 128 | "cache_last_updated": null, | ||
129 | "cache_url": null, | 129 | "cache_url": null, | ||
130 | "created": "2021-11-23T21:55:51.837852", | 130 | "created": "2021-11-23T21:55:51.837852", | ||
131 | "data_collection_info": "n/a", | 131 | "data_collection_info": "n/a", | ||
132 | "data_processing": "n/a", | 132 | "data_processing": "n/a", | ||
133 | "datastore_active": false, | 133 | "datastore_active": false, | ||
134 | "description": "In 2019, the Lake Windermere Ambassadors | 134 | "description": "In 2019, the Lake Windermere Ambassadors | ||
135 | collected physical and chemical water quality parameters at three | 135 | collected physical and chemical water quality parameters at three | ||
136 | sample sites on Lake Windermere once weekly during the summer, from | 136 | sample sites on Lake Windermere once weekly during the summer, from | ||
137 | late May to September. The lake sampling regime included water | 137 | late May to September. The lake sampling regime included water | ||
138 | temperature, turbidity/clarity, pH, conductivity, depth, and dissolved | 138 | temperature, turbidity/clarity, pH, conductivity, depth, and dissolved | ||
139 | oxygen. Once monthly from May to September we collected Total | 139 | oxygen. Once monthly from May to September we collected Total | ||
140 | Dissolved Phosphorus and Total Phosphorous. In addition, the LWA | 140 | Dissolved Phosphorus and Total Phosphorous. In addition, the LWA | ||
141 | monitored substrate samplers at six sites on the east side of Lake | 141 | monitored substrate samplers at six sites on the east side of Lake | ||
142 | Windermere for invasive mussels, as well as monitoring tributary flows | 142 | Windermere for invasive mussels, as well as monitoring tributary flows | ||
143 | and water quality at the outlet of Windermere Creek and Abel Creek. E. | 143 | and water quality at the outlet of Windermere Creek and Abel Creek. E. | ||
144 | coli data was collected at public swim beaches weekly, from May until | 144 | coli data was collected at public swim beaches weekly, from May until | ||
145 | September, excluding weeks with a statutory holiday Monday, in | 145 | September, excluding weeks with a statutory holiday Monday, in | ||
146 | partnership with the Interior Health Authority. Lastly, Goldeneye | 146 | partnership with the Interior Health Authority. Lastly, Goldeneye | ||
147 | Ecological Services was contracted to complete an aquatic plant | 147 | Ecological Services was contracted to complete an aquatic plant | ||
148 | survey, and fall waterbird survey on Lake Windermere.", | 148 | survey, and fall waterbird survey on Lake Windermere.", | ||
149 | "format": "PDF", | 149 | "format": "PDF", | ||
150 | "hash": "3d388a54d7dc9fef6df16bd80732492f", | 150 | "hash": "3d388a54d7dc9fef6df16bd80732492f", | ||
151 | "header_row": "", | 151 | "header_row": "", | ||
152 | "id": "d9db0064-520b-4e59-a537-4164219cb5bf", | 152 | "id": "d9db0064-520b-4e59-a537-4164219cb5bf", | ||
153 | "last_modified": "2021-11-23T21:55:51.776932", | 153 | "last_modified": "2021-11-23T21:55:51.776932", | ||
154 | "metadata_modified": "2021-11-23T21:55:51.837852", | 154 | "metadata_modified": "2021-11-23T21:55:51.837852", | ||
155 | "mimetype": "application/pdf", | 155 | "mimetype": "application/pdf", | ||
156 | "mimetype_inner": null, | 156 | "mimetype_inner": null, | ||
157 | "name": "Water Quality Monitoring Program 2019 Final Report", | 157 | "name": "Water Quality Monitoring Program 2019 Final Report", | ||
158 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 158 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
159 | "position": 1, | 159 | "position": 1, | ||
160 | "resource_citation": "McGinty (2019). Lake Windermere Community | 160 | "resource_citation": "McGinty (2019). Lake Windermere Community | ||
161 | Based Water Quality Monitoring Program 2019 Final Report. Prepared for | 161 | Based Water Quality Monitoring Program 2019 Final Report. Prepared for | ||
162 | Lake Windermere Ambassadors. Columbia Basin Water Hub | 162 | Lake Windermere Ambassadors. Columbia Basin Water Hub | ||
163 | (Resource).\u00a0 Invermere. DOI", | 163 | (Resource).\u00a0 Invermere. DOI", | ||
164 | "resource_data_disclaimer": "No warranty or guarantee exists | 164 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
165 | that the information is accurate, complete, current, or suitable for | 165 | that the information is accurate, complete, current, or suitable for | ||
166 | any purpose. The individual user must confirm the accuracy of the data | 166 | any purpose. The individual user must confirm the accuracy of the data | ||
167 | and whether it will be appropriate for their purpose.", | 167 | and whether it will be appropriate for their purpose.", | ||
168 | "resource_location": "Lake Windermere", | 168 | "resource_location": "Lake Windermere", | ||
169 | "resource_type": null, | 169 | "resource_type": null, | ||
170 | "size": 2320463, | 170 | "size": 2320463, | ||
171 | "state": "active", | 171 | "state": "active", | ||
172 | "url": | 172 | "url": | ||
173 | wa_mcginty_report_lkwindermerewaterqualitymonitoringprogram_2019.pdf", | 173 | wa_mcginty_report_lkwindermerewaterqualitymonitoringprogram_2019.pdf", | ||
174 | "url_type": "upload", | 174 | "url_type": "upload", | ||
175 | "waterhub_certified": "Certified", | 175 | "waterhub_certified": "Certified", | ||
176 | "waterhub_grade": "People and Perspectives" | 176 | "waterhub_grade": "People and Perspectives" | ||
177 | }, | 177 | }, | ||
178 | { | 178 | { | ||
179 | "cache_last_updated": null, | 179 | "cache_last_updated": null, | ||
180 | "cache_url": null, | 180 | "cache_url": null, | ||
181 | "created": "2021-11-23T22:24:53.420732", | 181 | "created": "2021-11-23T22:24:53.420732", | ||
182 | "data_collection_info": "n/a", | 182 | "data_collection_info": "n/a", | ||
183 | "data_processing": "n/a", | 183 | "data_processing": "n/a", | ||
184 | "datastore_active": false, | 184 | "datastore_active": false, | ||
185 | "description": "In 2018, the LWA collected physical and chemical | 185 | "description": "In 2018, the LWA collected physical and chemical | ||
186 | water quality parameters at three sample sites on Lake Windermere. | 186 | water quality parameters at three sample sites on Lake Windermere. | ||
187 | Once weekly during the summer from late May to mid-September, the lake | 187 | Once weekly during the summer from late May to mid-September, the lake | ||
188 | sampling regime included: water temperature, turbidity/clarity, pH, | 188 | sampling regime included: water temperature, turbidity/clarity, pH, | ||
189 | conductivity, depth, and dissolved oxygen. Once monthly from April to | 189 | conductivity, depth, and dissolved oxygen. Once monthly from April to | ||
190 | August, we collected samples for Total and Total Dissolved | 190 | August, we collected samples for Total and Total Dissolved | ||
191 | Phosphorous. The LWA also collected E. coli data at public swim | 191 | Phosphorous. The LWA also collected E. coli data at public swim | ||
192 | beaches in partnership with the Interior Health Authority, and | 192 | beaches in partnership with the Interior Health Authority, and | ||
193 | monitored tributary flows and water quality at the outlet of | 193 | monitored tributary flows and water quality at the outlet of | ||
194 | Windermere Creek and Abel Creek. Lastly, we conducted an aquatic plant | 194 | Windermere Creek and Abel Creek. Lastly, we conducted an aquatic plant | ||
195 | survey as well as a fall waterbird survey on Lake Windermere with the | 195 | survey as well as a fall waterbird survey on Lake Windermere with the | ||
196 | help and expertise of Goldeneye Ecological Services.\r\n", | 196 | help and expertise of Goldeneye Ecological Services.\r\n", | ||
197 | "format": "PDF", | 197 | "format": "PDF", | ||
198 | "hash": "7a5d9b8bb4af9de2305cffe8928edd30", | 198 | "hash": "7a5d9b8bb4af9de2305cffe8928edd30", | ||
199 | "header_row": "", | 199 | "header_row": "", | ||
200 | "id": "aa6c989d-266e-4f8c-a666-fed3782c1cb1", | 200 | "id": "aa6c989d-266e-4f8c-a666-fed3782c1cb1", | ||
201 | "last_modified": "2021-11-23T22:24:53.353134", | 201 | "last_modified": "2021-11-23T22:24:53.353134", | ||
202 | "metadata_modified": "2021-11-23T22:24:53.420732", | 202 | "metadata_modified": "2021-11-23T22:24:53.420732", | ||
203 | "mimetype": "application/pdf", | 203 | "mimetype": "application/pdf", | ||
204 | "mimetype_inner": null, | 204 | "mimetype_inner": null, | ||
205 | "name": "Water Quality Monitoring Program 2018 Final Report", | 205 | "name": "Water Quality Monitoring Program 2018 Final Report", | ||
206 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 206 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
207 | "position": 2, | 207 | "position": 2, | ||
208 | "resource_citation": "Rodgers (2018). Lake Windermere | 208 | "resource_citation": "Rodgers (2018). Lake Windermere | ||
209 | Community-Based Water Quality Monitoring Program 2018 Final Report. | 209 | Community-Based Water Quality Monitoring Program 2018 Final Report. | ||
210 | Prepared for Lake Windermere Ambassadors. Columbia Basin Water Hub. | 210 | Prepared for Lake Windermere Ambassadors. Columbia Basin Water Hub. | ||
211 | (Resource). Invermere. (DOI)", | 211 | (Resource). Invermere. (DOI)", | ||
212 | "resource_data_disclaimer": "No warranty or guarantee exists | 212 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
213 | that the information is accurate, complete, current, or suitable for | 213 | that the information is accurate, complete, current, or suitable for | ||
214 | any purpose. The individual user must confirm the accuracy of the data | 214 | any purpose. The individual user must confirm the accuracy of the data | ||
215 | and whether it will be appropriate for their purpose.", | 215 | and whether it will be appropriate for their purpose.", | ||
216 | "resource_location": "Lake Windermere", | 216 | "resource_location": "Lake Windermere", | ||
217 | "resource_type": null, | 217 | "resource_type": null, | ||
218 | "size": 2382873, | 218 | "size": 2382873, | ||
219 | "state": "active", | 219 | "state": "active", | ||
220 | "url": | 220 | "url": | ||
221 | rt_lkwindermerecommunity-basedwaterqualitymonitoringprogram_2018.pdf", | 221 | rt_lkwindermerecommunity-basedwaterqualitymonitoringprogram_2018.pdf", | ||
222 | "url_type": "upload", | 222 | "url_type": "upload", | ||
223 | "waterhub_certified": "Certified", | 223 | "waterhub_certified": "Certified", | ||
224 | "waterhub_grade": "People and Perspectives" | 224 | "waterhub_grade": "People and Perspectives" | ||
225 | }, | 225 | }, | ||
226 | { | 226 | { | ||
227 | "cache_last_updated": null, | 227 | "cache_last_updated": null, | ||
228 | "cache_url": null, | 228 | "cache_url": null, | ||
229 | "created": "2021-11-23T22:37:40.342909", | 229 | "created": "2021-11-23T22:37:40.342909", | ||
230 | "data_collection_info": "n/a", | 230 | "data_collection_info": "n/a", | ||
231 | "data_processing": "n/a", | 231 | "data_processing": "n/a", | ||
232 | "datastore_active": false, | 232 | "datastore_active": false, | ||
233 | "description": "In 2017, the LWA collected physical and chemical | 233 | "description": "In 2017, the LWA collected physical and chemical | ||
234 | water quality parameters at three sample sites on Lake Windermere. | 234 | water quality parameters at three sample sites on Lake Windermere. | ||
235 | Once weekly during the summer from mid-June to mid-September, the lake | 235 | Once weekly during the summer from mid-June to mid-September, the lake | ||
236 | sampling regime included: temperature, turbidity/clarity, pH, | 236 | sampling regime included: temperature, turbidity/clarity, pH, | ||
237 | conductivity, depth, dissolved oxygen, and Total and Dissolved | 237 | conductivity, depth, dissolved oxygen, and Total and Dissolved | ||
238 | Phosphorous. The LWA also collected E. coli data at public swim | 238 | Phosphorous. The LWA also collected E. coli data at public swim | ||
239 | beaches with the support of the Interior Health Authority, and | 239 | beaches with the support of the Interior Health Authority, and | ||
240 | monitored tributary flows and water quality at the outlet of | 240 | monitored tributary flows and water quality at the outlet of | ||
241 | Windermere Creek with the support of the Columbia Basin Water Quality | 241 | Windermere Creek with the support of the Columbia Basin Water Quality | ||
242 | Monitoring Project (CBWQ). Finally, we conducted an aquatic plant and | 242 | Monitoring Project (CBWQ). Finally, we conducted an aquatic plant and | ||
243 | invasive veliger survey with the help and expertise of the East | 243 | invasive veliger survey with the help and expertise of the East | ||
244 | Kootenay Invasive Species Council and Goldeneye Ecological Services.", | 244 | Kootenay Invasive Species Council and Goldeneye Ecological Services.", | ||
245 | "format": "PDF", | 245 | "format": "PDF", | ||
246 | "hash": "", | 246 | "hash": "", | ||
247 | "header_row": "", | 247 | "header_row": "", | ||
248 | "id": "8d13ec2c-6a7b-4dab-bb00-ff525d787063", | 248 | "id": "8d13ec2c-6a7b-4dab-bb00-ff525d787063", | ||
249 | "last_modified": null, | 249 | "last_modified": null, | ||
250 | "metadata_modified": "2021-11-23T22:37:40.342909", | 250 | "metadata_modified": "2021-11-23T22:37:40.342909", | ||
251 | "mimetype": null, | 251 | "mimetype": null, | ||
252 | "mimetype_inner": null, | 252 | "mimetype_inner": null, | ||
253 | "name": "Lake Windermere 2017 Water Quality Monitoring Results", | 253 | "name": "Lake Windermere 2017 Water Quality Monitoring Results", | ||
254 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 254 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
255 | "position": 3, | 255 | "position": 3, | ||
256 | "resource_citation": "Rodgers (2017). Lake Windermere 2017 Water | 256 | "resource_citation": "Rodgers (2017). Lake Windermere 2017 Water | ||
257 | Quality Monitoring Results. Prepared for Lake Windermere Ambassadors. | 257 | Quality Monitoring Results. Prepared for Lake Windermere Ambassadors. | ||
258 | Columbia Basin Water Hub (Resource).\u00a0Invermere (DOI)", | 258 | Columbia Basin Water Hub (Resource).\u00a0Invermere (DOI)", | ||
259 | "resource_data_disclaimer": "No warranty or guarantee exists | 259 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
260 | that the information is accurate, complete, current, or suitable for | 260 | that the information is accurate, complete, current, or suitable for | ||
261 | any purpose. The individual user must confirm the accuracy of the data | 261 | any purpose. The individual user must confirm the accuracy of the data | ||
262 | and whether it will be appropriate for their purpose.", | 262 | and whether it will be appropriate for their purpose.", | ||
263 | "resource_location": "Lake Windermere", | 263 | "resource_location": "Lake Windermere", | ||
264 | "resource_type": null, | 264 | "resource_type": null, | ||
265 | "size": null, | 265 | "size": null, | ||
266 | "state": "active", | 266 | "state": "active", | ||
267 | "url": "", | 267 | "url": "", | ||
268 | "url_type": null, | 268 | "url_type": null, | ||
269 | "waterhub_certified": "Certified", | 269 | "waterhub_certified": "Certified", | ||
270 | "waterhub_grade": "People and Perspectives" | 270 | "waterhub_grade": "People and Perspectives" | ||
271 | }, | 271 | }, | ||
272 | { | 272 | { | ||
273 | "cache_last_updated": null, | 273 | "cache_last_updated": null, | ||
274 | "cache_url": null, | 274 | "cache_url": null, | ||
275 | "created": "2021-11-23T22:49:43.365126", | 275 | "created": "2021-11-23T22:49:43.365126", | ||
276 | "data_collection_info": "n/a", | 276 | "data_collection_info": "n/a", | ||
277 | "data_processing": "n/a", | 277 | "data_processing": "n/a", | ||
278 | "datastore_active": false, | 278 | "datastore_active": false, | ||
279 | "description": "2016 marked the eleventh year of lake monitoring | 279 | "description": "2016 marked the eleventh year of lake monitoring | ||
280 | since the Lake Windermere Project started data collection in 2006. The | 280 | since the Lake Windermere Project started data collection in 2006. The | ||
281 | spring and summer of 2014-2016 brought mild climatic conditions | 281 | spring and summer of 2014-2016 brought mild climatic conditions | ||
282 | without the major flooding events which characterized 2012-2013. | 282 | without the major flooding events which characterized 2012-2013. | ||
283 | Measured lake depths in 2016 were comparable to those in 2006-2008, | 283 | Measured lake depths in 2016 were comparable to those in 2006-2008, | ||
284 | and shallower than average levels in more recent years (2012, 2014). | 284 | and shallower than average levels in more recent years (2012, 2014). | ||
285 | Lake Windermere met Objectives for temperature, dissolved oxygen, and | 285 | Lake Windermere met Objectives for temperature, dissolved oxygen, and | ||
286 | turbidity throughout the summer. This means the water was clear, cool, | 286 | turbidity throughout the summer. This means the water was clear, cool, | ||
287 | and well oxygenated: all in line with historic levels. Beach | 287 | and well oxygenated: all in line with historic levels. Beach | ||
288 | monitoring results showed that shoreline bacteria levels did not | 288 | monitoring results showed that shoreline bacteria levels did not | ||
289 | exceed the recommended Guidelines for safe swimming on any of Lake | 289 | exceed the recommended Guidelines for safe swimming on any of Lake | ||
290 | Windermere\u2019s public beaches over the summer.", | 290 | Windermere\u2019s public beaches over the summer.", | ||
291 | "format": "PDF", | 291 | "format": "PDF", | ||
292 | "hash": "2273882fe388dc8ddcc3350075dccb34", | 292 | "hash": "2273882fe388dc8ddcc3350075dccb34", | ||
293 | "header_row": "", | 293 | "header_row": "", | ||
294 | "id": "f9919c08-5a37-4277-9c64-4fca6cb1e3ed", | 294 | "id": "f9919c08-5a37-4277-9c64-4fca6cb1e3ed", | ||
295 | "last_modified": "2021-11-23T22:49:43.289338", | 295 | "last_modified": "2021-11-23T22:49:43.289338", | ||
296 | "metadata_modified": "2021-11-23T22:49:43.365126", | 296 | "metadata_modified": "2021-11-23T22:49:43.365126", | ||
297 | "mimetype": "application/pdf", | 297 | "mimetype": "application/pdf", | ||
298 | "mimetype_inner": null, | 298 | "mimetype_inner": null, | ||
299 | "name": "Lake Windermere 2016 Water Quality Monitoring Results", | 299 | "name": "Lake Windermere 2016 Water Quality Monitoring Results", | ||
300 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 300 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
301 | "position": 4, | 301 | "position": 4, | ||
302 | "resource_citation": "Peloso (2017). Lake Windermere 2016 Water | 302 | "resource_citation": "Peloso (2017). Lake Windermere 2016 Water | ||
303 | Quality Monitoring Results. Prepared for Lake Windermere Ambassadors. | 303 | Quality Monitoring Results. Prepared for Lake Windermere Ambassadors. | ||
304 | Columbia Basin Water Hub (Resource).\u00a0Invermere. (DOI)\u2028", | 304 | Columbia Basin Water Hub (Resource).\u00a0Invermere. (DOI)\u2028", | ||
305 | "resource_data_disclaimer": "No warranty or guarantee exists | 305 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
306 | that the information is accurate, complete, current, or suitable for | 306 | that the information is accurate, complete, current, or suitable for | ||
307 | any purpose. The individual user must confirm the accuracy of the data | 307 | any purpose. The individual user must confirm the accuracy of the data | ||
308 | and whether it will be appropriate for their purpose.", | 308 | and whether it will be appropriate for their purpose.", | ||
309 | "resource_location": "Lake Windermere", | 309 | "resource_location": "Lake Windermere", | ||
310 | "resource_type": null, | 310 | "resource_type": null, | ||
311 | "size": 1299939, | 311 | "size": 1299939, | ||
312 | "state": "active", | 312 | "state": "active", | ||
313 | "url": | 313 | "url": | ||
314 | loso_report_lakewindermere2016waterqualitymonitoringresults_2016.pdf", | 314 | loso_report_lakewindermere2016waterqualitymonitoringresults_2016.pdf", | ||
315 | "url_type": "upload", | 315 | "url_type": "upload", | ||
316 | "waterhub_certified": "Certified", | 316 | "waterhub_certified": "Certified", | ||
317 | "waterhub_grade": "People and Perspectives" | 317 | "waterhub_grade": "People and Perspectives" | ||
318 | }, | 318 | }, | ||
319 | { | 319 | { | ||
320 | "cache_last_updated": null, | 320 | "cache_last_updated": null, | ||
321 | "cache_url": null, | 321 | "cache_url": null, | ||
322 | "created": "2021-11-23T23:05:34.834141", | 322 | "created": "2021-11-23T23:05:34.834141", | ||
323 | "data_collection_info": "n/a", | 323 | "data_collection_info": "n/a", | ||
324 | "data_processing": "n/a", | 324 | "data_processing": "n/a", | ||
325 | "datastore_active": false, | 325 | "datastore_active": false, | ||
326 | "description": "2015 marked the tenth year of lake monitoring | 326 | "description": "2015 marked the tenth year of lake monitoring | ||
327 | since the Lake Windermere Project started data collection in 2006. The | 327 | since the Lake Windermere Project started data collection in 2006. The | ||
328 | spring and summer of 2014 and 2015 brought mild climatic conditions | 328 | spring and summer of 2014 and 2015 brought mild climatic conditions | ||
329 | without the major flooding events which characterized 2012 and 2013. | 329 | without the major flooding events which characterized 2012 and 2013. | ||
330 | Measured lake depths in 2015 were comparable to those in 2006-2008, | 330 | Measured lake depths in 2015 were comparable to those in 2006-2008, | ||
331 | and shallower than average levels in more recent years (2012, 2014). | 331 | and shallower than average levels in more recent years (2012, 2014). | ||
332 | Lake Windermere met Objectives for temperature, dissolved oxygen, and | 332 | Lake Windermere met Objectives for temperature, dissolved oxygen, and | ||
333 | turbidity throughout the summer. This means the water was clear, cool, | 333 | turbidity throughout the summer. This means the water was clear, cool, | ||
334 | and well oxygenated: all in line with historic levels. Beach | 334 | and well oxygenated: all in line with historic levels. Beach | ||
335 | monitoring results show that shoreline bacteria levels did not exceed | 335 | monitoring results show that shoreline bacteria levels did not exceed | ||
336 | the recommended Guidelines for safe swimming on any of Lake | 336 | the recommended Guidelines for safe swimming on any of Lake | ||
337 | Windermere\u2019s public beaches over the summer.\r\nTotal phosphorus | 337 | Windermere\u2019s public beaches over the summer.\r\nTotal phosphorus | ||
338 | levels at ice-off exceeded the Objective for the Lake at two sampling | 338 | levels at ice-off exceeded the Objective for the Lake at two sampling | ||
339 | stations in 2015. A slight increasing trend in this nutrient has been | 339 | stations in 2015. A slight increasing trend in this nutrient has been | ||
340 | observed in the lake in recent years, warranting continued monitoring | 340 | observed in the lake in recent years, warranting continued monitoring | ||
341 | in conjunction with efforts on land to keep excess nutrients out of | 341 | in conjunction with efforts on land to keep excess nutrients out of | ||
342 | the lake.", | 342 | the lake.", | ||
343 | "format": "PDF", | 343 | "format": "PDF", | ||
344 | "hash": "0a33c447193b2f26f74036fde504639c", | 344 | "hash": "0a33c447193b2f26f74036fde504639c", | ||
345 | "header_row": "", | 345 | "header_row": "", | ||
346 | "id": "d27e444f-a734-4e40-bc8d-56fc4f3f4755", | 346 | "id": "d27e444f-a734-4e40-bc8d-56fc4f3f4755", | ||
347 | "last_modified": "2021-11-23T23:05:34.756954", | 347 | "last_modified": "2021-11-23T23:05:34.756954", | ||
348 | "metadata_modified": "2021-11-23T23:05:34.834141", | 348 | "metadata_modified": "2021-11-23T23:05:34.834141", | ||
349 | "mimetype": "application/pdf", | 349 | "mimetype": "application/pdf", | ||
350 | "mimetype_inner": null, | 350 | "mimetype_inner": null, | ||
351 | "name": "Lake Windermere 2015 Water Quality Monitoring Results", | 351 | "name": "Lake Windermere 2015 Water Quality Monitoring Results", | ||
352 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 352 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
353 | "position": 5, | 353 | "position": 5, | ||
354 | "resource_citation": "Peloso (2016). Lake Windermere 2015 Water | 354 | "resource_citation": "Peloso (2016). Lake Windermere 2015 Water | ||
355 | Quality Monitoring Results. Prepared for Lake Windermere Ambassadors. | 355 | Quality Monitoring Results. Prepared for Lake Windermere Ambassadors. | ||
356 | Columbia Basin Water Hub (Resource).\u00a0Invermere. (DOI)\u2028", | 356 | Columbia Basin Water Hub (Resource).\u00a0Invermere. (DOI)\u2028", | ||
357 | "resource_data_disclaimer": "No warranty or guarantee exists | 357 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
358 | that the information is accurate, complete, current, or suitable for | 358 | that the information is accurate, complete, current, or suitable for | ||
359 | any purpose. The individual user must confirm the accuracy of the data | 359 | any purpose. The individual user must confirm the accuracy of the data | ||
360 | and whether it will be appropriate for their purpose.", | 360 | and whether it will be appropriate for their purpose.", | ||
361 | "resource_location": "Lake Windermere", | 361 | "resource_location": "Lake Windermere", | ||
362 | "resource_type": null, | 362 | "resource_type": null, | ||
363 | "size": 1182081, | 363 | "size": 1182081, | ||
364 | "state": "active", | 364 | "state": "active", | ||
365 | "url": | 365 | "url": | ||
366 | peloso_report_lkwindermere2015waterqualitymonitoringresults_2015.pdf", | 366 | peloso_report_lkwindermere2015waterqualitymonitoringresults_2015.pdf", | ||
367 | "url_type": "upload", | 367 | "url_type": "upload", | ||
368 | "waterhub_certified": "Certified", | 368 | "waterhub_certified": "Certified", | ||
369 | "waterhub_grade": "People and Perspectives" | 369 | "waterhub_grade": "People and Perspectives" | ||
370 | }, | 370 | }, | ||
371 | { | 371 | { | ||
372 | "cache_last_updated": null, | 372 | "cache_last_updated": null, | ||
373 | "cache_url": null, | 373 | "cache_url": null, | ||
374 | "created": "2021-11-23T23:13:35.771622", | 374 | "created": "2021-11-23T23:13:35.771622", | ||
375 | "data_collection_info": "n/a", | 375 | "data_collection_info": "n/a", | ||
376 | "data_processing": "n/a", | 376 | "data_processing": "n/a", | ||
377 | "datastore_active": false, | 377 | "datastore_active": false, | ||
378 | "description": "The spring and summer of 2014 brought mild | 378 | "description": "The spring and summer of 2014 brought mild | ||
379 | climatic conditions without the major flooding events which | 379 | climatic conditions without the major flooding events which | ||
380 | characterized 2012 and 2013. The measured lake depths in 2014 were | 380 | characterized 2012 and 2013. The measured lake depths in 2014 were | ||
381 | comparable to those in 2012, and deeper than average levels between | 381 | comparable to those in 2012, and deeper than average levels between | ||
382 | 2006-2008 and 2011. Lake Windermere met Objectives for temperature, | 382 | 2006-2008 and 2011. Lake Windermere met Objectives for temperature, | ||
383 | dissolved oxygen, and turbidity throughout the summer. This means the | 383 | dissolved oxygen, and turbidity throughout the summer. This means the | ||
384 | water was clear, cool, and well oxygenated: all in line with historic | 384 | water was clear, cool, and well oxygenated: all in line with historic | ||
385 | levels. The beaches were clean in 2014. Measured beach bacteria levels | 385 | levels. The beaches were clean in 2014. Measured beach bacteria levels | ||
386 | did not exceed the recommended Guidelines for safe swimming on any of | 386 | did not exceed the recommended Guidelines for safe swimming on any of | ||
387 | the public beaches over the summer.\r\nTotal phosphorus levels | 387 | the public beaches over the summer.\r\nTotal phosphorus levels | ||
388 | exceeded the Objective for the Lake at one sampling station in 2014. A | 388 | exceeded the Objective for the Lake at one sampling station in 2014. A | ||
389 | slight increasing trend in this nutrient has been observed in the lake | 389 | slight increasing trend in this nutrient has been observed in the lake | ||
390 | in recent years, warranting close monitoring of this critical nutrient | 390 | in recent years, warranting close monitoring of this critical nutrient | ||
391 | and continued efforts on land to keep excess nutrients out of the | 391 | and continued efforts on land to keep excess nutrients out of the | ||
392 | lake.", | 392 | lake.", | ||
393 | "format": "PDF", | 393 | "format": "PDF", | ||
394 | "hash": "e334758dfd79acfeccd9491fa45c4147", | 394 | "hash": "e334758dfd79acfeccd9491fa45c4147", | ||
395 | "header_row": "", | 395 | "header_row": "", | ||
396 | "id": "7c715f2d-aeb5-416d-b153-98e7e9b6c60c", | 396 | "id": "7c715f2d-aeb5-416d-b153-98e7e9b6c60c", | ||
397 | "last_modified": "2021-12-08T21:32:37.277837", | 397 | "last_modified": "2021-12-08T21:32:37.277837", | ||
398 | "metadata_modified": "2021-11-23T23:13:35.771622", | 398 | "metadata_modified": "2021-11-23T23:13:35.771622", | ||
399 | "mimetype": "application/pdf", | 399 | "mimetype": "application/pdf", | ||
400 | "mimetype_inner": null, | 400 | "mimetype_inner": null, | ||
401 | "name": "Lake Windermere 2014 Water Quality Monitoring Results", | 401 | "name": "Lake Windermere 2014 Water Quality Monitoring Results", | ||
402 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 402 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
403 | "position": 6, | 403 | "position": 6, | ||
404 | "resource_citation": "Harma (2014). Lake Windermere 2014 Water | 404 | "resource_citation": "Harma (2014). Lake Windermere 2014 Water | ||
405 | Quality Monitoring Results. Prepared for Lake Windermere Ambassadors. | 405 | Quality Monitoring Results. Prepared for Lake Windermere Ambassadors. | ||
406 | Columbia Basin Water Hub (Resource).\u00a0Invermere. (DOI)\u2028", | 406 | Columbia Basin Water Hub (Resource).\u00a0Invermere. (DOI)\u2028", | ||
407 | "resource_data_disclaimer": "No warranty or guarantee exists | 407 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
408 | that the information is accurate, complete, current, or suitable for | 408 | that the information is accurate, complete, current, or suitable for | ||
409 | any purpose. The individual user must confirm the accuracy of the data | 409 | any purpose. The individual user must confirm the accuracy of the data | ||
410 | and whether it will be appropriate for their purpose.", | 410 | and whether it will be appropriate for their purpose.", | ||
411 | "resource_location": "Lake Windermere", | 411 | "resource_location": "Lake Windermere", | ||
412 | "resource_type": null, | 412 | "resource_type": null, | ||
413 | "size": 857404, | 413 | "size": 857404, | ||
414 | "state": "active", | 414 | "state": "active", | ||
415 | "url": | 415 | "url": | ||
416 | _harma_report_lkwindermere2014waterqualitymonitoringresults_2014.pdf", | 416 | _harma_report_lkwindermere2014waterqualitymonitoringresults_2014.pdf", | ||
417 | "url_type": "upload", | 417 | "url_type": "upload", | ||
418 | "waterhub_certified": "Certified", | 418 | "waterhub_certified": "Certified", | ||
419 | "waterhub_grade": "People and Perspectives" | 419 | "waterhub_grade": "People and Perspectives" | ||
420 | }, | 420 | }, | ||
421 | { | 421 | { | ||
422 | "cache_last_updated": null, | 422 | "cache_last_updated": null, | ||
423 | "cache_url": null, | 423 | "cache_url": null, | ||
424 | "created": "2021-11-23T23:20:00.004349", | 424 | "created": "2021-11-23T23:20:00.004349", | ||
425 | "data_collection_info": "n/a", | 425 | "data_collection_info": "n/a", | ||
426 | "data_processing": "n/a", | 426 | "data_processing": "n/a", | ||
427 | "datastore_active": false, | 427 | "datastore_active": false, | ||
428 | "description": "In 2013, Lake Windermere Ambassadors\u2019 | 428 | "description": "In 2013, Lake Windermere Ambassadors\u2019 | ||
429 | volunteers and staff sampled lake water at three locations monitored | 429 | volunteers and staff sampled lake water at three locations monitored | ||
430 | historically by the Ministry of Environment and then by the Lake | 430 | historically by the Ministry of Environment and then by the Lake | ||
431 | Windermere Project. The sites cover the North and South end and center | 431 | Windermere Project. The sites cover the North and South end and center | ||
432 | (Mid) of the lake.", | 432 | (Mid) of the lake.", | ||
433 | "format": "PDF", | 433 | "format": "PDF", | ||
434 | "hash": "bdb58a784524585c0227d709834fcbf6", | 434 | "hash": "bdb58a784524585c0227d709834fcbf6", | ||
435 | "header_row": "", | 435 | "header_row": "", | ||
436 | "id": "c7780c0f-2ffd-4ed9-96b1-c2f502aebf94", | 436 | "id": "c7780c0f-2ffd-4ed9-96b1-c2f502aebf94", | ||
437 | "last_modified": "2021-11-23T23:19:59.923080", | 437 | "last_modified": "2021-11-23T23:19:59.923080", | ||
438 | "metadata_modified": "2021-11-23T23:20:00.004349", | 438 | "metadata_modified": "2021-11-23T23:20:00.004349", | ||
439 | "mimetype": "application/pdf", | 439 | "mimetype": "application/pdf", | ||
440 | "mimetype_inner": null, | 440 | "mimetype_inner": null, | ||
441 | "name": "Lake Windermere 2013 Water Quality Monitoring Results", | 441 | "name": "Lake Windermere 2013 Water Quality Monitoring Results", | ||
442 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 442 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
443 | "position": 7, | 443 | "position": 7, | ||
444 | "resource_citation": "Lake Windermere Ambassadors (2013). Lake | 444 | "resource_citation": "Lake Windermere Ambassadors (2013). Lake | ||
445 | Windermere 2013 Water Quality Monitoring Results. Columbia Basin Water | 445 | Windermere 2013 Water Quality Monitoring Results. Columbia Basin Water | ||
446 | Hub (Resource).\u00a0Invermere. (DOI)\u2028", | 446 | Hub (Resource).\u00a0Invermere. (DOI)\u2028", | ||
447 | "resource_data_disclaimer": "No warranty or guarantee exists | 447 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
448 | that the information is accurate, complete, current, or suitable for | 448 | that the information is accurate, complete, current, or suitable for | ||
449 | any purpose. The individual user must confirm the accuracy of the data | 449 | any purpose. The individual user must confirm the accuracy of the data | ||
450 | and whether it will be appropriate for their purpose.", | 450 | and whether it will be appropriate for their purpose.", | ||
451 | "resource_location": "Lake Windermere", | 451 | "resource_location": "Lake Windermere", | ||
452 | "resource_type": null, | 452 | "resource_type": null, | ||
453 | "size": 1093839, | 453 | "size": 1093839, | ||
454 | "state": "active", | 454 | "state": "active", | ||
455 | "url": | 455 | "url": | ||
456 | sadors_report_lkwindermere2013waterqualitymonitoringresults_2013.pdf", | 456 | sadors_report_lkwindermere2013waterqualitymonitoringresults_2013.pdf", | ||
457 | "url_type": "upload", | 457 | "url_type": "upload", | ||
458 | "waterhub_certified": "Certified", | 458 | "waterhub_certified": "Certified", | ||
459 | "waterhub_grade": "People and Perspectives" | 459 | "waterhub_grade": "People and Perspectives" | ||
460 | }, | 460 | }, | ||
461 | { | 461 | { | ||
462 | "cache_last_updated": null, | 462 | "cache_last_updated": null, | ||
463 | "cache_url": null, | 463 | "cache_url": null, | ||
464 | "created": "2021-11-23T23:23:42.836926", | 464 | "created": "2021-11-23T23:23:42.836926", | ||
465 | "data_collection_info": "n/a", | 465 | "data_collection_info": "n/a", | ||
466 | "data_processing": "n/a", | 466 | "data_processing": "n/a", | ||
467 | "datastore_active": false, | 467 | "datastore_active": false, | ||
468 | "description": "In 2012 Lake Windermere Ambassadors\u2019 | 468 | "description": "In 2012 Lake Windermere Ambassadors\u2019 | ||
469 | volunteers and staff sampled lake water at three locations established | 469 | volunteers and staff sampled lake water at three locations established | ||
470 | by the Ministry of Environment and sampled over 5 years by the Lake | 470 | by the Ministry of Environment and sampled over 5 years by the Lake | ||
471 | Windermere Project. The sites cover the north and south end and center | 471 | Windermere Project. The sites cover the north and south end and center | ||
472 | of the lake.", | 472 | of the lake.", | ||
473 | "format": "PDF", | 473 | "format": "PDF", | ||
474 | "hash": "ad2d38e5d5b1caffd6a5abfe4c726287", | 474 | "hash": "ad2d38e5d5b1caffd6a5abfe4c726287", | ||
475 | "header_row": "", | 475 | "header_row": "", | ||
476 | "id": "67b8ff61-5811-4c87-bce3-86c79e22822b", | 476 | "id": "67b8ff61-5811-4c87-bce3-86c79e22822b", | ||
477 | "last_modified": "2021-11-23T23:23:42.751096", | 477 | "last_modified": "2021-11-23T23:23:42.751096", | ||
478 | "metadata_modified": "2021-11-23T23:23:42.836926", | 478 | "metadata_modified": "2021-11-23T23:23:42.836926", | ||
479 | "mimetype": "application/pdf", | 479 | "mimetype": "application/pdf", | ||
480 | "mimetype_inner": null, | 480 | "mimetype_inner": null, | ||
481 | "name": "Lake Windermere 2012 Water Quality Monitoring Results", | 481 | "name": "Lake Windermere 2012 Water Quality Monitoring Results", | ||
482 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 482 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
483 | "position": 8, | 483 | "position": 8, | ||
484 | "resource_citation": "Lake Windermere Ambassadors (2012). Lake | 484 | "resource_citation": "Lake Windermere Ambassadors (2012). Lake | ||
485 | Windermere 2012 Water Quality Monitoring Results. Columbia Basin Water | 485 | Windermere 2012 Water Quality Monitoring Results. Columbia Basin Water | ||
486 | Hub (Resource).\u00a0Invermere. (DOI)\u2028", | 486 | Hub (Resource).\u00a0Invermere. (DOI)\u2028", | ||
487 | "resource_data_disclaimer": "No warranty or guarantee exists | 487 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
488 | that the information is accurate, complete, current, or suitable for | 488 | that the information is accurate, complete, current, or suitable for | ||
489 | any purpose. The individual user must confirm the accuracy of the data | 489 | any purpose. The individual user must confirm the accuracy of the data | ||
490 | and whether it will be appropriate for their purpose.", | 490 | and whether it will be appropriate for their purpose.", | ||
491 | "resource_location": "Lake Windermere", | 491 | "resource_location": "Lake Windermere", | ||
492 | "resource_type": null, | 492 | "resource_type": null, | ||
493 | "size": 1603461, | 493 | "size": 1603461, | ||
494 | "state": "active", | 494 | "state": "active", | ||
495 | "url": | 495 | "url": | ||
496 | sadors_report_lkwindermere2012waterqualitymonitoringresults_2012.pdf", | 496 | sadors_report_lkwindermere2012waterqualitymonitoringresults_2012.pdf", | ||
497 | "url_type": "upload", | 497 | "url_type": "upload", | ||
498 | "waterhub_certified": "Certified", | 498 | "waterhub_certified": "Certified", | ||
499 | "waterhub_grade": "People and Perspectives" | 499 | "waterhub_grade": "People and Perspectives" | ||
500 | }, | 500 | }, | ||
501 | { | 501 | { | ||
502 | "cache_last_updated": null, | 502 | "cache_last_updated": null, | ||
503 | "cache_url": null, | 503 | "cache_url": null, | ||
504 | "created": "2021-11-23T23:27:43.105066", | 504 | "created": "2021-11-23T23:27:43.105066", | ||
505 | "data_collection_info": "n/a", | 505 | "data_collection_info": "n/a", | ||
506 | "data_processing": "n/a", | 506 | "data_processing": "n/a", | ||
507 | "datastore_active": false, | 507 | "datastore_active": false, | ||
508 | "description": "In 2011 Lake Windermere Ambassadors\u2019 | 508 | "description": "In 2011 Lake Windermere Ambassadors\u2019 | ||
509 | volunteers and staff sampled lake water at three locations established | 509 | volunteers and staff sampled lake water at three locations established | ||
510 | by the Ministry of Environment and sampled over the previous 5 years | 510 | by the Ministry of Environment and sampled over the previous 5 years | ||
511 | by the Lake Windermere Project. The sites cover the north and south | 511 | by the Lake Windermere Project. The sites cover the north and south | ||
512 | end and center of the lake.", | 512 | end and center of the lake.", | ||
513 | "format": "PDF", | 513 | "format": "PDF", | ||
514 | "hash": "2f17535074d077048b73718bf4fc99ed", | 514 | "hash": "2f17535074d077048b73718bf4fc99ed", | ||
515 | "header_row": "", | 515 | "header_row": "", | ||
516 | "id": "dcf1f2c2-9ce2-4bc3-a8c8-7b0719be9dd5", | 516 | "id": "dcf1f2c2-9ce2-4bc3-a8c8-7b0719be9dd5", | ||
517 | "last_modified": "2021-11-23T23:27:43.016982", | 517 | "last_modified": "2021-11-23T23:27:43.016982", | ||
518 | "load_status": "Invalid header row: ", | 518 | "load_status": "Invalid header row: ", | ||
519 | "metadata_modified": "2021-11-23T23:27:43.105066", | 519 | "metadata_modified": "2021-11-23T23:27:43.105066", | ||
520 | "mimetype": "application/pdf", | 520 | "mimetype": "application/pdf", | ||
521 | "mimetype_inner": null, | 521 | "mimetype_inner": null, | ||
522 | "name": "Lake Windermere 2011 Water Quality Monitoring Results", | 522 | "name": "Lake Windermere 2011 Water Quality Monitoring Results", | ||
523 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 523 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
524 | "position": 9, | 524 | "position": 9, | ||
525 | "resource_citation": "Lake Windermere Ambassadors (2011). Lake | 525 | "resource_citation": "Lake Windermere Ambassadors (2011). Lake | ||
526 | Windermere 2011 Water Quality Monitoring Results. Columbia Basin | 526 | Windermere 2011 Water Quality Monitoring Results. Columbia Basin | ||
527 | Water Hub (Resource).\u00a0Invermere. (DOI)\u2028", | 527 | Water Hub (Resource).\u00a0Invermere. (DOI)\u2028", | ||
528 | "resource_data_disclaimer": "No warranty or guarantee exists | 528 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
529 | that the information is accurate, complete, current, or suitable for | 529 | that the information is accurate, complete, current, or suitable for | ||
530 | any purpose. The individual user must confirm the accuracy of the data | 530 | any purpose. The individual user must confirm the accuracy of the data | ||
531 | and whether it will be appropriate for their purpose.", | 531 | and whether it will be appropriate for their purpose.", | ||
532 | "resource_location": "Lake Windermere", | 532 | "resource_location": "Lake Windermere", | ||
533 | "resource_type": null, | 533 | "resource_type": null, | ||
534 | "size": 1593707, | 534 | "size": 1593707, | ||
535 | "state": "active", | 535 | "state": "active", | ||
536 | "url": | 536 | "url": | ||
537 | sadors_report_lkwindermere2011waterqualitymonitoringresults_2011.pdf", | 537 | sadors_report_lkwindermere2011waterqualitymonitoringresults_2011.pdf", | ||
538 | "url_type": "upload", | 538 | "url_type": "upload", | ||
539 | "waterhub_certified": "Certified", | 539 | "waterhub_certified": "Certified", | ||
540 | "waterhub_grade": "Not Reviewed" | 540 | "waterhub_grade": "Not Reviewed" | ||
541 | }, | 541 | }, | ||
542 | { | 542 | { | ||
543 | "cache_last_updated": null, | 543 | "cache_last_updated": null, | ||
544 | "cache_url": null, | 544 | "cache_url": null, | ||
545 | "created": "2021-11-23T23:35:04.672563", | 545 | "created": "2021-11-23T23:35:04.672563", | ||
546 | "data_collection_info": "n/a", | 546 | "data_collection_info": "n/a", | ||
547 | "data_processing": "n/a", | 547 | "data_processing": "n/a", | ||
548 | "datastore_active": false, | 548 | "datastore_active": false, | ||
549 | "description": "The objectives of this water quality monitoring | 549 | "description": "The objectives of this water quality monitoring | ||
550 | report are as follows:\r\n1. Present CABIN, sediment and water | 550 | report are as follows:\r\n1. Present CABIN, sediment and water | ||
551 | quality, and continual stream temperature data collected to date in a | 551 | quality, and continual stream temperature data collected to date in a | ||
552 | format that can be used for analysis and ongoing assessment.\r\n2. | 552 | format that can be used for analysis and ongoing assessment.\r\n2. | ||
553 | Analyse biological monitoring data (CABIN). Complete the analysis | 553 | Analyse biological monitoring data (CABIN). Complete the analysis | ||
554 | using the analytical tools in the CABIN database by classifying | 554 | using the analytical tools in the CABIN database by classifying | ||
555 | benthic invertebrate community stress at sampling sites according the | 555 | benthic invertebrate community stress at sampling sites according the | ||
556 | Reference Condition Approach and calculating invertebrate community | 556 | Reference Condition Approach and calculating invertebrate community | ||
557 | metrics.\r\n3. Analyse water and sediment quality data to identify if | 557 | metrics.\r\n3. Analyse water and sediment quality data to identify if | ||
558 | there were any parameters of potential concern in the study area. | 558 | there were any parameters of potential concern in the study area. | ||
559 | Complete this review by comparing monitoring results to applicable | 559 | Complete this review by comparing monitoring results to applicable | ||
560 | federal and provincial guidelines for the protection of aquatic life | 560 | federal and provincial guidelines for the protection of aquatic life | ||
561 | and drinking water, where available.\r\n4. Analyse stream temperature | 561 | and drinking water, where available.\r\n4. Analyse stream temperature | ||
562 | data obtained from the continual data logger(s).\r\n5. Relate | 562 | data obtained from the continual data logger(s).\r\n5. Relate | ||
563 | biological results to water/sediment quality and stream temperature | 563 | biological results to water/sediment quality and stream temperature | ||
564 | findings.\r\n6. Provide recommendations for future stream health data | 564 | findings.\r\n6. Provide recommendations for future stream health data | ||
565 | collection including applicable data to be collected, locations to be | 565 | collection including applicable data to be collected, locations to be | ||
566 | sampled, and procedures.", | 566 | sampled, and procedures.", | ||
567 | "format": "PDF", | 567 | "format": "PDF", | ||
568 | "hash": "04badeed083a9d66712fcc286d31092d", | 568 | "hash": "04badeed083a9d66712fcc286d31092d", | ||
569 | "header_row": "", | 569 | "header_row": "", | ||
570 | "id": "121fbbc0-d5cc-4ac2-ad41-e9f00e2eba47", | 570 | "id": "121fbbc0-d5cc-4ac2-ad41-e9f00e2eba47", | ||
571 | "last_modified": "2021-11-23T23:35:04.581894", | 571 | "last_modified": "2021-11-23T23:35:04.581894", | ||
572 | "metadata_modified": "2021-11-23T23:35:04.672563", | 572 | "metadata_modified": "2021-11-23T23:35:04.672563", | ||
573 | "mimetype": "application/pdf", | 573 | "mimetype": "application/pdf", | ||
574 | "mimetype_inner": null, | 574 | "mimetype_inner": null, | ||
575 | "name": "Water Quality Monitoring Report 2009 \u2013 2012", | 575 | "name": "Water Quality Monitoring Report 2009 \u2013 2012", | ||
576 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 576 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
577 | "position": 10, | 577 | "position": 10, | ||
578 | "resource_citation": "McPherson, S., K. Kuchapski, and R. | 578 | "resource_citation": "McPherson, S., K. Kuchapski, and R. | ||
579 | MacDonald. 2014. Windermere Creek 2009-2012, water quality monitoring | 579 | MacDonald. 2014. Windermere Creek 2009-2012, water quality monitoring | ||
580 | report. A Columbia Basin Water Quality Monitoring Project. Prepared by | 580 | report. A Columbia Basin Water Quality Monitoring Project. Prepared by | ||
581 | Lotic Environmental Ltd. for Wildsight.", | 581 | Lotic Environmental Ltd. for Wildsight.", | ||
582 | "resource_data_disclaimer": "No warranty or guarantee exists | 582 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
583 | that the information is accurate, complete, current, or suitable for | 583 | that the information is accurate, complete, current, or suitable for | ||
584 | any purpose. The individual user must confirm the accuracy of the data | 584 | any purpose. The individual user must confirm the accuracy of the data | ||
585 | and whether it will be appropriate for their purpose.", | 585 | and whether it will be appropriate for their purpose.", | ||
586 | "resource_location": "Windermere Creek", | 586 | "resource_location": "Windermere Creek", | ||
587 | "resource_type": null, | 587 | "resource_type": null, | ||
588 | "size": 1166753, | 588 | "size": 1166753, | ||
589 | "state": "active", | 589 | "state": "active", | ||
590 | "url": | 590 | "url": | ||
591 | ntal_report_windermerecreekwaterqualitymonitoringreport2009_2012.pdf", | 591 | ntal_report_windermerecreekwaterqualitymonitoringreport2009_2012.pdf", | ||
592 | "url_type": "upload", | 592 | "url_type": "upload", | ||
593 | "waterhub_certified": "Certified", | 593 | "waterhub_certified": "Certified", | ||
594 | "waterhub_grade": "People and Perspectives" | 594 | "waterhub_grade": "People and Perspectives" | ||
595 | }, | 595 | }, | ||
596 | { | 596 | { | ||
597 | "cache_last_updated": null, | 597 | "cache_last_updated": null, | ||
598 | "cache_url": null, | 598 | "cache_url": null, | ||
599 | "created": "2021-11-23T21:47:42.044031", | 599 | "created": "2021-11-23T21:47:42.044031", | ||
600 | "data_collection_info": "n/a", | 600 | "data_collection_info": "n/a", | ||
601 | "data_processing": "n/a", | 601 | "data_processing": "n/a", | ||
602 | "datastore_active": false, | 602 | "datastore_active": false, | ||
n | n | 603 | "datastore_status": "", | ||
603 | "description": "Data and information included in this report is | 604 | "description": "Data and information included in this report is | ||
604 | a first and preliminary examination of results from Windermere Creek | 605 | a first and preliminary examination of results from Windermere Creek | ||
605 | (BC), which consists of a list of the macroinvertebrate taxa detected | 606 | (BC), which consists of a list of the macroinvertebrate taxa detected | ||
606 | within the samples submitted. This report aims to highlight the | 607 | within the samples submitted. This report aims to highlight the | ||
607 | different macroinvertebrate EPT taxa and provide basic richness | 608 | different macroinvertebrate EPT taxa and provide basic richness | ||
608 | metrics as a useful contribution for community groups to assess river | 609 | metrics as a useful contribution for community groups to assess river | ||
609 | health.", | 610 | health.", | ||
610 | "format": "PDF", | 611 | "format": "PDF", | ||
611 | "hash": "5a1afd2f11385df53ebcddc0131d43f9", | 612 | "hash": "5a1afd2f11385df53ebcddc0131d43f9", | ||
612 | "header_row": "", | 613 | "header_row": "", | ||
613 | "id": "04d7f4c8-f731-4980-aa59-8c8a1a0db5bf", | 614 | "id": "04d7f4c8-f731-4980-aa59-8c8a1a0db5bf", | ||
614 | "last_modified": "2021-11-23T21:47:41.981461", | 615 | "last_modified": "2021-11-23T21:47:41.981461", | ||
615 | "load_status": "Invalid header row: ", | 616 | "load_status": "Invalid header row: ", | ||
n | 616 | "metadata_modified": "2021-11-23T21:47:42.044031", | n | 617 | "metadata_modified": "2022-05-12T14:51:20.536884", |
617 | "mimetype": "application/pdf", | 618 | "mimetype": "application/pdf", | ||
618 | "mimetype_inner": null, | 619 | "mimetype_inner": null, | ||
619 | "name": "Preliminary DNA Data Windermere Creek, BC Columbia | 620 | "name": "Preliminary DNA Data Windermere Creek, BC Columbia | ||
620 | Basin Water Quality Monitoring Project - Windermere Creek", | 621 | Basin Water Quality Monitoring Project - Windermere Creek", | ||
621 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 622 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
622 | "position": 11, | 623 | "position": 11, | ||
n | 623 | "resource_citation": "Lake Windermere Ambassadors (2019). | n | 624 | "resource_citation": "Lake Windermere Ambassadors. (2019). |
624 | Preliminary DNA Data Windermere Creek, BC Columbia Basin Water Quality | 625 | Preliminary DNA Data Windermere Creek, BC Columbia Basin Water Quality | ||
625 | Monitoring Project - Windermere Creek. Prepared for WWF Canada, | 626 | Monitoring Project - Windermere Creek. Prepared for WWF Canada, | ||
626 | Environment and Climate Change Canada, Living Lakes Canada. Columbia | 627 | Environment and Climate Change Canada, Living Lakes Canada. Columbia | ||
n | 627 | Basin Water Hub (Resource). Invermere. (DOI)", | n | 628 | Basin Water Hub [Resource]. Invermere. |
629 | https://doi.org/10.48511/KBGB-DJ25", | ||||
628 | "resource_data_disclaimer": "No warranty or guarantee exists | 630 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
629 | that the information is accurate, complete, current, or suitable for | 631 | that the information is accurate, complete, current, or suitable for | ||
630 | any purpose. The individual user must confirm the accuracy of the data | 632 | any purpose. The individual user must confirm the accuracy of the data | ||
631 | and whether it will be appropriate for their purpose.", | 633 | and whether it will be appropriate for their purpose.", | ||
632 | "resource_location": "Windermere Creek", | 634 | "resource_location": "Windermere Creek", | ||
633 | "resource_type": null, | 635 | "resource_type": null, | ||
634 | "size": 408000, | 636 | "size": 408000, | ||
635 | "state": "active", | 637 | "state": "active", | ||
636 | "url": | 638 | "url": | ||
637 | ermere-ambassadors_report_preliminarydnadatawindermerecreek_2019.pdf", | 639 | ermere-ambassadors_report_preliminarydnadatawindermerecreek_2019.pdf", | ||
638 | "url_type": "upload", | 640 | "url_type": "upload", | ||
639 | "waterhub_certified": "Certified", | 641 | "waterhub_certified": "Certified", | ||
t | 640 | "waterhub_grade": "Not Reviewed" | t | 642 | "waterhub_grade": "People and Perspectives" |
641 | }, | 643 | }, | ||
642 | { | 644 | { | ||
643 | "cache_last_updated": null, | 645 | "cache_last_updated": null, | ||
644 | "cache_url": null, | 646 | "cache_url": null, | ||
645 | "created": "2021-11-23T22:10:12.978806", | 647 | "created": "2021-11-23T22:10:12.978806", | ||
646 | "data_collection_info": "n/a", | 648 | "data_collection_info": "n/a", | ||
647 | "data_processing": "n/a", | 649 | "data_processing": "n/a", | ||
648 | "datastore_active": false, | 650 | "datastore_active": false, | ||
649 | "description": "No aquatic invasive plant species were detected | 651 | "description": "No aquatic invasive plant species were detected | ||
650 | during shoreline surveys. There was a notable lack of aquatic plants | 652 | during shoreline surveys. There was a notable lack of aquatic plants | ||
651 | detected at the following survey stations: Baltac Beach, End of Ruault | 653 | detected at the following survey stations: Baltac Beach, End of Ruault | ||
652 | Rd, and Unofficial boat launch near Bayshore Condos.\r\n\r\nNo aquatic | 654 | Rd, and Unofficial boat launch near Bayshore Condos.\r\n\r\nNo aquatic | ||
653 | invasive plant species were detected during offshore surveys. As with | 655 | invasive plant species were detected during offshore surveys. As with | ||
654 | previous years of survey effort, dense areas or beds of indigenous | 656 | previous years of survey effort, dense areas or beds of indigenous | ||
655 | aquatic plants were observed in specific locations such as Ruault Road | 657 | aquatic plants were observed in specific locations such as Ruault Road | ||
656 | and Althalmer/Pete\u2019s Marina (Figure 1). There were some survey | 658 | and Althalmer/Pete\u2019s Marina (Figure 1). There were some survey | ||
657 | stations that were essentially devoid of aquatic plant communities, | 659 | stations that were essentially devoid of aquatic plant communities, | ||
658 | such as Baltac Beach, Unofficial boat launch near Bayshore Condos, and | 660 | such as Baltac Beach, Unofficial boat launch near Bayshore Condos, and | ||
659 | Tretheway Docks.", | 661 | Tretheway Docks.", | ||
660 | "format": "PDF", | 662 | "format": "PDF", | ||
661 | "hash": "6a3f5d12b394b13926e9fbb7552b66fa", | 663 | "hash": "6a3f5d12b394b13926e9fbb7552b66fa", | ||
662 | "header_row": "", | 664 | "header_row": "", | ||
663 | "id": "141a882d-dcb3-4ff2-bd42-3ee3fb580f0e", | 665 | "id": "141a882d-dcb3-4ff2-bd42-3ee3fb580f0e", | ||
664 | "last_modified": "2021-11-23T22:10:12.915634", | 666 | "last_modified": "2021-11-23T22:10:12.915634", | ||
665 | "metadata_modified": "2021-11-23T22:10:12.978806", | 667 | "metadata_modified": "2021-11-23T22:10:12.978806", | ||
666 | "mimetype": "application/pdf", | 668 | "mimetype": "application/pdf", | ||
667 | "mimetype_inner": null, | 669 | "mimetype_inner": null, | ||
668 | "name": "Aquatic Invasive Plant Species Inventory 2019", | 670 | "name": "Aquatic Invasive Plant Species Inventory 2019", | ||
669 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 671 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
670 | "position": 12, | 672 | "position": 12, | ||
671 | "resource_citation": "Darvill (2019). Lake Windermere Aquatic | 673 | "resource_citation": "Darvill (2019). Lake Windermere Aquatic | ||
672 | Invasive Plant Species Inventory 2019. Prepared for Lake Windermere | 674 | Invasive Plant Species Inventory 2019. Prepared for Lake Windermere | ||
673 | Ambassadors. Columbia Basin Water Hub (Resource).\u00a0Parson. (DOI)", | 675 | Ambassadors. Columbia Basin Water Hub (Resource).\u00a0Parson. (DOI)", | ||
674 | "resource_data_disclaimer": "No warranty or guarantee exists | 676 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
675 | that the information is accurate, complete, current, or suitable for | 677 | that the information is accurate, complete, current, or suitable for | ||
676 | any purpose. The individual user must confirm the accuracy of the data | 678 | any purpose. The individual user must confirm the accuracy of the data | ||
677 | and whether it will be appropriate for their purpose.", | 679 | and whether it will be appropriate for their purpose.", | ||
678 | "resource_location": "Lake Windermere", | 680 | "resource_location": "Lake Windermere", | ||
679 | "resource_type": null, | 681 | "resource_type": null, | ||
680 | "size": 1454992, | 682 | "size": 1454992, | ||
681 | "state": "active", | 683 | "state": "active", | ||
682 | "url": | 684 | "url": | ||
683 | _report_lakewindermereaquaticinvasiveplantspecies-inventory_2019.pdf", | 685 | _report_lakewindermereaquaticinvasiveplantspecies-inventory_2019.pdf", | ||
684 | "url_type": "upload", | 686 | "url_type": "upload", | ||
685 | "waterhub_certified": "Certified", | 687 | "waterhub_certified": "Certified", | ||
686 | "waterhub_grade": "People and Perspectives" | 688 | "waterhub_grade": "People and Perspectives" | ||
687 | }, | 689 | }, | ||
688 | { | 690 | { | ||
689 | "cache_last_updated": null, | 691 | "cache_last_updated": null, | ||
690 | "cache_url": null, | 692 | "cache_url": null, | ||
691 | "created": "2021-11-23T22:31:35.205581", | 693 | "created": "2021-11-23T22:31:35.205581", | ||
692 | "data_collection_info": "n/a", | 694 | "data_collection_info": "n/a", | ||
693 | "data_processing": "n/a", | 695 | "data_processing": "n/a", | ||
694 | "datastore_active": false, | 696 | "datastore_active": false, | ||
695 | "description": "No aquatic invasive plant species were detected | 697 | "description": "No aquatic invasive plant species were detected | ||
696 | during shoreline surveys. Aquatic invasive plant species detection is | 698 | during shoreline surveys. Aquatic invasive plant species detection is | ||
697 | the primary focus on this study. However, all native plant species | 699 | the primary focus on this study. However, all native plant species | ||
698 | that were collected through rake pulls are listed in Appendix 1. | 700 | that were collected through rake pulls are listed in Appendix 1. | ||
699 | \r\n\r\nAll offshore sampling resulted in no aquatic invasive plant | 701 | \r\n\r\nAll offshore sampling resulted in no aquatic invasive plant | ||
700 | species being detected. As with previous years of survey effort, dense | 702 | species being detected. As with previous years of survey effort, dense | ||
701 | areas of native aquatic plants were observed in locations such as | 703 | areas of native aquatic plants were observed in locations such as | ||
702 | Ruault Road and Althalmer/Pete\u2019s Marina. While aquatic invasive | 704 | Ruault Road and Althalmer/Pete\u2019s Marina. While aquatic invasive | ||
703 | plant detection was the primary focus of this study, all native | 705 | plant detection was the primary focus of this study, all native | ||
704 | aquatic plants were identified to the species level where possible, | 706 | aquatic plants were identified to the species level where possible, | ||
705 | and are listed in Appendix 2.", | 707 | and are listed in Appendix 2.", | ||
706 | "format": "PDF", | 708 | "format": "PDF", | ||
707 | "hash": "97d2fed2747971fb1bd9e1bc07637600", | 709 | "hash": "97d2fed2747971fb1bd9e1bc07637600", | ||
708 | "header_row": "", | 710 | "header_row": "", | ||
709 | "id": "bff727d2-e463-4a01-9c21-768180cbb0f5", | 711 | "id": "bff727d2-e463-4a01-9c21-768180cbb0f5", | ||
710 | "last_modified": "2021-11-23T22:31:35.136576", | 712 | "last_modified": "2021-11-23T22:31:35.136576", | ||
711 | "metadata_modified": "2021-11-23T22:31:35.205581", | 713 | "metadata_modified": "2021-11-23T22:31:35.205581", | ||
712 | "mimetype": "application/pdf", | 714 | "mimetype": "application/pdf", | ||
713 | "mimetype_inner": null, | 715 | "mimetype_inner": null, | ||
714 | "name": "Aquatic Invasive Plant Species Inventory 2018", | 716 | "name": "Aquatic Invasive Plant Species Inventory 2018", | ||
715 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 717 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
716 | "position": 13, | 718 | "position": 13, | ||
717 | "resource_citation": "Darvill (2018). Lake Windermere Aquatic | 719 | "resource_citation": "Darvill (2018). Lake Windermere Aquatic | ||
718 | Invasive Plant Species Inventory 2018. Prepared for Lake Windermere | 720 | Invasive Plant Species Inventory 2018. Prepared for Lake Windermere | ||
719 | Ambassadors. Columbia Basin Water Hub (Resource).\u00a0 Parson. | 721 | Ambassadors. Columbia Basin Water Hub (Resource).\u00a0 Parson. | ||
720 | (DOI)", | 722 | (DOI)", | ||
721 | "resource_data_disclaimer": "No warranty or guarantee exists | 723 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
722 | that the information is accurate, complete, current, or suitable for | 724 | that the information is accurate, complete, current, or suitable for | ||
723 | any purpose. The individual user must confirm the accuracy of the data | 725 | any purpose. The individual user must confirm the accuracy of the data | ||
724 | and whether it will be appropriate for their purpose.", | 726 | and whether it will be appropriate for their purpose.", | ||
725 | "resource_location": "Lake Windermere", | 727 | "resource_location": "Lake Windermere", | ||
726 | "resource_type": null, | 728 | "resource_type": null, | ||
727 | "size": 1354021, | 729 | "size": 1354021, | ||
728 | "state": "active", | 730 | "state": "active", | ||
729 | "url": | 731 | "url": | ||
730 | darvill_report_lakewindermereaquaticinvasiveplantsinventory_2018.pdf", | 732 | darvill_report_lakewindermereaquaticinvasiveplantsinventory_2018.pdf", | ||
731 | "url_type": "upload", | 733 | "url_type": "upload", | ||
732 | "waterhub_certified": "Certified", | 734 | "waterhub_certified": "Certified", | ||
733 | "waterhub_grade": "People and Perspectives" | 735 | "waterhub_grade": "People and Perspectives" | ||
734 | }, | 736 | }, | ||
735 | { | 737 | { | ||
736 | "cache_last_updated": null, | 738 | "cache_last_updated": null, | ||
737 | "cache_url": null, | 739 | "cache_url": null, | ||
738 | "created": "2021-11-23T22:44:38.629271", | 740 | "created": "2021-11-23T22:44:38.629271", | ||
739 | "data_collection_info": "n/a", | 741 | "data_collection_info": "n/a", | ||
740 | "data_processing": "n/a", | 742 | "data_processing": "n/a", | ||
741 | "datastore_active": false, | 743 | "datastore_active": false, | ||
742 | "description": "No aquatic invasive plant species were detected | 744 | "description": "No aquatic invasive plant species were detected | ||
743 | during the shoreline surveys. Aquatic invasive plant species detection | 745 | during the shoreline surveys. Aquatic invasive plant species detection | ||
744 | is the primary focus on this study; however, all native plant species | 746 | is the primary focus on this study; however, all native plant species | ||
745 | that were collected through rake pulls are listed in Appendix 1. | 747 | that were collected through rake pulls are listed in Appendix 1. | ||
746 | \r\n\r\nAll offshore sampling resulted in the detection of no aquatic | 748 | \r\n\r\nAll offshore sampling resulted in the detection of no aquatic | ||
747 | invasive plant species. Multiple beds of dense native aquatic plants | 749 | invasive plant species. Multiple beds of dense native aquatic plants | ||
748 | were located in locations such as Ruault Road and | 750 | were located in locations such as Ruault Road and | ||
749 | Althalmer/Pete\u2019s Marina. While aquatic invasive plant detection | 751 | Althalmer/Pete\u2019s Marina. While aquatic invasive plant detection | ||
750 | was the primary focus of this study, all native aquatic plants were | 752 | was the primary focus of this study, all native aquatic plants were | ||
751 | identified to the species level where possible, and are listed in | 753 | identified to the species level where possible, and are listed in | ||
752 | Appendix 2.\r\n\r\nAll veliger samples submitted by the EKISP to the | 754 | Appendix 2.\r\n\r\nAll veliger samples submitted by the EKISP to the | ||
753 | appropriate laboratory were reported back to the EKISC as negative. | 755 | appropriate laboratory were reported back to the EKISC as negative. | ||
754 | This indicates that no invasive mussel (Zebra Mussel (Dreissena | 756 | This indicates that no invasive mussel (Zebra Mussel (Dreissena | ||
755 | polymorph)/Quagga Mussel (Dreissena bugensis) veligers were identified | 757 | polymorph)/Quagga Mussel (Dreissena bugensis) veligers were identified | ||
756 | by the laboratory that analyzed the samples.", | 758 | by the laboratory that analyzed the samples.", | ||
757 | "format": "PDF", | 759 | "format": "PDF", | ||
758 | "hash": "2cc5a8ceb551df27d99f5f9718a11f46", | 760 | "hash": "2cc5a8ceb551df27d99f5f9718a11f46", | ||
759 | "header_row": "", | 761 | "header_row": "", | ||
760 | "id": "8cebdc8d-85ed-4c17-941e-3c50e4d84cd4", | 762 | "id": "8cebdc8d-85ed-4c17-941e-3c50e4d84cd4", | ||
761 | "last_modified": "2021-11-23T22:44:38.559073", | 763 | "last_modified": "2021-11-23T22:44:38.559073", | ||
762 | "metadata_modified": "2021-11-23T22:44:38.629271", | 764 | "metadata_modified": "2021-11-23T22:44:38.629271", | ||
763 | "mimetype": "application/pdf", | 765 | "mimetype": "application/pdf", | ||
764 | "mimetype_inner": null, | 766 | "mimetype_inner": null, | ||
765 | "name": "Aquatic Invasive Species Inventory 2017", | 767 | "name": "Aquatic Invasive Species Inventory 2017", | ||
766 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 768 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
767 | "position": 14, | 769 | "position": 14, | ||
768 | "resource_citation": "Darvill (2017). Lake Windermere Aquatic | 770 | "resource_citation": "Darvill (2017). Lake Windermere Aquatic | ||
769 | Invasive Species Inventory 2017. Prepared for Lake Windermere | 771 | Invasive Species Inventory 2017. Prepared for Lake Windermere | ||
770 | Ambassadors. Columbia Basin Water Hub (Resource).\u00a0Parson. | 772 | Ambassadors. Columbia Basin Water Hub (Resource).\u00a0Parson. | ||
771 | (DOI)\u2028", | 773 | (DOI)\u2028", | ||
772 | "resource_data_disclaimer": "No warranty or guarantee exists | 774 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
773 | that the information is accurate, complete, current, or suitable for | 775 | that the information is accurate, complete, current, or suitable for | ||
774 | any purpose. The individual user must confirm the accuracy of the data | 776 | any purpose. The individual user must confirm the accuracy of the data | ||
775 | and whether it will be appropriate for their purpose.", | 777 | and whether it will be appropriate for their purpose.", | ||
776 | "resource_location": "Lake Windermere", | 778 | "resource_location": "Lake Windermere", | ||
777 | "resource_type": null, | 779 | "resource_type": null, | ||
778 | "size": 1501477, | 780 | "size": 1501477, | ||
779 | "state": "active", | 781 | "state": "active", | ||
780 | "url": | 782 | "url": | ||
781 | darvill_report_lakewindermereaquaticinvasiveplantsinventory_2017.pdf", | 783 | darvill_report_lakewindermereaquaticinvasiveplantsinventory_2017.pdf", | ||
782 | "url_type": "upload", | 784 | "url_type": "upload", | ||
783 | "waterhub_certified": "Certified", | 785 | "waterhub_certified": "Certified", | ||
784 | "waterhub_grade": "People and Perspectives" | 786 | "waterhub_grade": "People and Perspectives" | ||
785 | }, | 787 | }, | ||
786 | { | 788 | { | ||
787 | "cache_last_updated": null, | 789 | "cache_last_updated": null, | ||
788 | "cache_url": null, | 790 | "cache_url": null, | ||
789 | "created": "2021-11-23T22:57:01.513020", | 791 | "created": "2021-11-23T22:57:01.513020", | ||
790 | "data_collection_info": "n/a", | 792 | "data_collection_info": "n/a", | ||
791 | "data_processing": "n/a", | 793 | "data_processing": "n/a", | ||
792 | "datastore_active": false, | 794 | "datastore_active": false, | ||
793 | "description": "The purpose of conducting AIS monitoring on Lake | 795 | "description": "The purpose of conducting AIS monitoring on Lake | ||
794 | Windermere in 2016 is to sample both offshore and onshore locations | 796 | Windermere in 2016 is to sample both offshore and onshore locations | ||
795 | for AIS such as Eurasian Watermilfoil (Myriophyllum spicatum), | 797 | for AIS such as Eurasian Watermilfoil (Myriophyllum spicatum), | ||
796 | Curyleaf Pondweed (Potamogeton crispu), Zebra Mussel (Dreissena | 798 | Curyleaf Pondweed (Potamogeton crispu), Zebra Mussel (Dreissena | ||
797 | polymorph) and Quagga Mussel (Dreissena bugensis). Continuing to | 799 | polymorph) and Quagga Mussel (Dreissena bugensis). Continuing to | ||
798 | sample for AIS on an annual basis on Lake Windermere will facilitate a | 800 | sample for AIS on an annual basis on Lake Windermere will facilitate a | ||
799 | rapid response for any detected species within this high risk lake | 801 | rapid response for any detected species within this high risk lake | ||
800 | ecosystem.", | 802 | ecosystem.", | ||
801 | "format": "PDF", | 803 | "format": "PDF", | ||
802 | "hash": "0e9235356278419204fd47722949065b", | 804 | "hash": "0e9235356278419204fd47722949065b", | ||
803 | "header_row": "", | 805 | "header_row": "", | ||
804 | "id": "cf49cf49-5e4a-494a-bb7f-5fd57fc88c02", | 806 | "id": "cf49cf49-5e4a-494a-bb7f-5fd57fc88c02", | ||
805 | "last_modified": "2021-11-23T22:57:01.438585", | 807 | "last_modified": "2021-11-23T22:57:01.438585", | ||
806 | "metadata_modified": "2021-11-23T22:57:01.513020", | 808 | "metadata_modified": "2021-11-23T22:57:01.513020", | ||
807 | "mimetype": "application/pdf", | 809 | "mimetype": "application/pdf", | ||
808 | "mimetype_inner": null, | 810 | "mimetype_inner": null, | ||
809 | "name": "Aquatic Invasive Species Sampling 2016", | 811 | "name": "Aquatic Invasive Species Sampling 2016", | ||
810 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 812 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
811 | "position": 15, | 813 | "position": 15, | ||
812 | "resource_citation": "Darvill (2016). Lake Windermere Aquatic | 814 | "resource_citation": "Darvill (2016). Lake Windermere Aquatic | ||
813 | Invasive Species Sampling 2016. Prepared for Lake Windermere | 815 | Invasive Species Sampling 2016. Prepared for Lake Windermere | ||
814 | Ambassadors. Columbia Basin Water Hub (Resource).\u00a0Parson. | 816 | Ambassadors. Columbia Basin Water Hub (Resource).\u00a0Parson. | ||
815 | (DOI)\u2028", | 817 | (DOI)\u2028", | ||
816 | "resource_data_disclaimer": "No warranty or guarantee exists | 818 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
817 | that the information is accurate, complete, current, or suitable for | 819 | that the information is accurate, complete, current, or suitable for | ||
818 | any purpose. The individual user must confirm the accuracy of the data | 820 | any purpose. The individual user must confirm the accuracy of the data | ||
819 | and whether it will be appropriate for their purpose.", | 821 | and whether it will be appropriate for their purpose.", | ||
820 | "resource_location": "Lake Windermere", | 822 | "resource_location": "Lake Windermere", | ||
821 | "resource_type": null, | 823 | "resource_type": null, | ||
822 | "size": 1528687, | 824 | "size": 1528687, | ||
823 | "state": "active", | 825 | "state": "active", | ||
824 | "url": | 826 | "url": | ||
825 | darvill_report_lakewindermereaquaticinvasiveplantsinventory_2016.pdf", | 827 | darvill_report_lakewindermereaquaticinvasiveplantsinventory_2016.pdf", | ||
826 | "url_type": "upload", | 828 | "url_type": "upload", | ||
827 | "waterhub_certified": "Certified", | 829 | "waterhub_certified": "Certified", | ||
828 | "waterhub_grade": "People and Perspectives" | 830 | "waterhub_grade": "People and Perspectives" | ||
829 | }, | 831 | }, | ||
830 | { | 832 | { | ||
831 | "cache_last_updated": null, | 833 | "cache_last_updated": null, | ||
832 | "cache_url": null, | 834 | "cache_url": null, | ||
833 | "created": "2021-11-23T23:10:09.741094", | 835 | "created": "2021-11-23T23:10:09.741094", | ||
834 | "data_collection_info": "n/a", | 836 | "data_collection_info": "n/a", | ||
835 | "data_processing": "n/a", | 837 | "data_processing": "n/a", | ||
836 | "datastore_active": false, | 838 | "datastore_active": false, | ||
837 | "description": "This year (2015) marked the sixth successive | 839 | "description": "This year (2015) marked the sixth successive | ||
838 | year (with the exception of 2013) where aquatic plants were sampled | 840 | year (with the exception of 2013) where aquatic plants were sampled | ||
839 | along multiple locations along the Lake Windermere shoreline. This | 841 | along multiple locations along the Lake Windermere shoreline. This | ||
840 | year also saw the first year of AIS sampling from a boat at offshore | 842 | year also saw the first year of AIS sampling from a boat at offshore | ||
841 | locations, including veliger sampling for invasive mussels (quagga and | 843 | locations, including veliger sampling for invasive mussels (quagga and | ||
842 | zebra).", | 844 | zebra).", | ||
843 | "format": "PDF", | 845 | "format": "PDF", | ||
844 | "hash": "c905077c6c7766a76ded7f930dc0f8ee", | 846 | "hash": "c905077c6c7766a76ded7f930dc0f8ee", | ||
845 | "header_row": "", | 847 | "header_row": "", | ||
846 | "id": "c52fe1c4-6791-4ac0-b1b8-5aa8123829f2", | 848 | "id": "c52fe1c4-6791-4ac0-b1b8-5aa8123829f2", | ||
847 | "last_modified": "2021-11-23T23:10:09.658955", | 849 | "last_modified": "2021-11-23T23:10:09.658955", | ||
848 | "metadata_modified": "2021-11-23T23:10:09.741094", | 850 | "metadata_modified": "2021-11-23T23:10:09.741094", | ||
849 | "mimetype": "application/pdf", | 851 | "mimetype": "application/pdf", | ||
850 | "mimetype_inner": null, | 852 | "mimetype_inner": null, | ||
851 | "name": "Aquatic Invasive Plant Sampling 2015", | 853 | "name": "Aquatic Invasive Plant Sampling 2015", | ||
852 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 854 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
853 | "position": 16, | 855 | "position": 16, | ||
854 | "resource_citation": "Darvill (2015). Lake Windermere Aquatic | 856 | "resource_citation": "Darvill (2015). Lake Windermere Aquatic | ||
855 | Invasive Plant Sampling 2015. Prepared for Lake Windermere | 857 | Invasive Plant Sampling 2015. Prepared for Lake Windermere | ||
856 | Ambassadors. Columbia Basin Water Hub (Resource).\u00a0Parson. | 858 | Ambassadors. Columbia Basin Water Hub (Resource).\u00a0Parson. | ||
857 | (DOI)\u2028", | 859 | (DOI)\u2028", | ||
858 | "resource_data_disclaimer": "No warranty or guarantee exists | 860 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
859 | that the information is accurate, complete, current, or suitable for | 861 | that the information is accurate, complete, current, or suitable for | ||
860 | any purpose. The individual user must confirm the accuracy of the data | 862 | any purpose. The individual user must confirm the accuracy of the data | ||
861 | and whether it will be appropriate for their purpose.", | 863 | and whether it will be appropriate for their purpose.", | ||
862 | "resource_location": "Lake Windermere", | 864 | "resource_location": "Lake Windermere", | ||
863 | "resource_type": null, | 865 | "resource_type": null, | ||
864 | "size": 894650, | 866 | "size": 894650, | ||
865 | "state": "active", | 867 | "state": "active", | ||
866 | "url": | 868 | "url": | ||
867 | darvill_report_lakewindermereaquaticinvasiveplantsinventory_2015.pdf", | 869 | darvill_report_lakewindermereaquaticinvasiveplantsinventory_2015.pdf", | ||
868 | "url_type": "upload", | 870 | "url_type": "upload", | ||
869 | "waterhub_certified": "Certified", | 871 | "waterhub_certified": "Certified", | ||
870 | "waterhub_grade": "People and Perspectives" | 872 | "waterhub_grade": "People and Perspectives" | ||
871 | }, | 873 | }, | ||
872 | { | 874 | { | ||
873 | "cache_last_updated": null, | 875 | "cache_last_updated": null, | ||
874 | "cache_url": null, | 876 | "cache_url": null, | ||
875 | "created": "2021-11-23T22:17:28.963537", | 877 | "created": "2021-11-23T22:17:28.963537", | ||
876 | "data_collection_info": "n/a", | 878 | "data_collection_info": "n/a", | ||
877 | "data_processing": "n/a", | 879 | "data_processing": "n/a", | ||
878 | "datastore_active": false, | 880 | "datastore_active": false, | ||
879 | "description": "The main purpose of this paper is to provide | 881 | "description": "The main purpose of this paper is to provide | ||
880 | information for what is currently known about the waterbird species | 882 | information for what is currently known about the waterbird species | ||
881 | that utilize Lake Windermere habitat. This report will provide the | 883 | that utilize Lake Windermere habitat. This report will provide the | ||
882 | findings of a single-day bird count conducted on the northern half of | 884 | findings of a single-day bird count conducted on the northern half of | ||
883 | Lake Windermere in September 2018. Lake Windermere bird data retrieved | 885 | Lake Windermere in September 2018. Lake Windermere bird data retrieved | ||
884 | from an online database (eBird) was reviewed and indicates that 165 | 886 | from an online database (eBird) was reviewed and indicates that 165 | ||
885 | bird species have been detected at Lake Windermere, 17 of these | 887 | bird species have been detected at Lake Windermere, 17 of these | ||
886 | species are considered to be at-risk. A review of historic and more | 888 | species are considered to be at-risk. A review of historic and more | ||
887 | recent bird data indicates that Lake Windermere contains important | 889 | recent bird data indicates that Lake Windermere contains important | ||
888 | bird habitat. The south end of the lake consistently has large | 890 | bird habitat. The south end of the lake consistently has large | ||
889 | concentrations of staging waterfowl during migration, and has the | 891 | concentrations of staging waterfowl during migration, and has the | ||
890 | highest single day bird counts resulting from a regional coordinated | 892 | highest single day bird counts resulting from a regional coordinated | ||
891 | bird count (i.e. Columbia Wetlands Waterbird Survey). When compared | 893 | bird count (i.e. Columbia Wetlands Waterbird Survey). When compared | ||
892 | across 105 survey stations in the Columbia Wetlands, the south end of | 894 | across 105 survey stations in the Columbia Wetlands, the south end of | ||
893 | Lake Windermere appears to contain the most important staging area | 895 | Lake Windermere appears to contain the most important staging area | ||
894 | within the continuous wetlands ecosystem for at-risk grebe species, as | 896 | within the continuous wetlands ecosystem for at-risk grebe species, as | ||
895 | well as for other bird species such as American coot. Creek mouths | 897 | well as for other bird species such as American coot. Creek mouths | ||
896 | found at Lake Windermere are also important habitat for birds, | 898 | found at Lake Windermere are also important habitat for birds, | ||
897 | especially for migrating shorebirds. Information on why birds are | 899 | especially for migrating shorebirds. Information on why birds are | ||
898 | important will be presented here, as well as a brief overview on the | 900 | important will be presented here, as well as a brief overview on the | ||
899 | decline of more than one-third of the world\u2019s bird populations. | 901 | decline of more than one-third of the world\u2019s bird populations. | ||
900 | Several suggestions for future action will be provided that may help | 902 | Several suggestions for future action will be provided that may help | ||
901 | to ensure that Lake Windermere continues to provide important habitat | 903 | to ensure that Lake Windermere continues to provide important habitat | ||
902 | to birds. These include: a) conducting additional fall bird surveys on | 904 | to birds. These include: a) conducting additional fall bird surveys on | ||
903 | the lake, b) completing spring breeding bird surveys in order to | 905 | the lake, b) completing spring breeding bird surveys in order to | ||
904 | assess the utilization of the lake area during a critical life history | 906 | assess the utilization of the lake area during a critical life history | ||
905 | stage and to identify and conserve key breeding sites, c) minimizing | 907 | stage and to identify and conserve key breeding sites, c) minimizing | ||
906 | boat traffic in and near nesting, staging, feeding areas during | 908 | boat traffic in and near nesting, staging, feeding areas during | ||
907 | specific times of year, d) public education regarding the importance | 909 | specific times of year, d) public education regarding the importance | ||
908 | of Lake Windermere to birds including at-risk species, and e) marking | 910 | of Lake Windermere to birds including at-risk species, and e) marking | ||
909 | the wildlife management area located at the south end of Lake | 911 | the wildlife management area located at the south end of Lake | ||
910 | Windermere with educational buoys alerting all recreational users of | 912 | Windermere with educational buoys alerting all recreational users of | ||
911 | this boundary (i.e. current legal restrictions make this area | 913 | this boundary (i.e. current legal restrictions make this area | ||
912 | off-limits to motorized water craft). Currently, there are fewer | 914 | off-limits to motorized water craft). Currently, there are fewer | ||
913 | significant wetland areas in the world remaining as habitat for birds. | 915 | significant wetland areas in the world remaining as habitat for birds. | ||
914 | These remaining key areas deserve conservation attention and | 916 | These remaining key areas deserve conservation attention and | ||
915 | recognition.", | 917 | recognition.", | ||
916 | "format": "PDF", | 918 | "format": "PDF", | ||
917 | "hash": "bf1420857dd34dceb70ac95a7802df06", | 919 | "hash": "bf1420857dd34dceb70ac95a7802df06", | ||
918 | "header_row": "", | 920 | "header_row": "", | ||
919 | "id": "6871538d-ae61-46cb-b7bb-0c7d8e2a2bc1", | 921 | "id": "6871538d-ae61-46cb-b7bb-0c7d8e2a2bc1", | ||
920 | "last_modified": "2021-11-23T22:17:28.898335", | 922 | "last_modified": "2021-11-23T22:17:28.898335", | ||
921 | "metadata_modified": "2021-11-23T22:17:28.963537", | 923 | "metadata_modified": "2021-11-23T22:17:28.963537", | ||
922 | "mimetype": "application/pdf", | 924 | "mimetype": "application/pdf", | ||
923 | "mimetype_inner": null, | 925 | "mimetype_inner": null, | ||
924 | "name": "Insight into the Waterbirds of Lake Windermere", | 926 | "name": "Insight into the Waterbirds of Lake Windermere", | ||
925 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 927 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
926 | "position": 17, | 928 | "position": 17, | ||
927 | "resource_citation": "Darvill (2019). Insight into the | 929 | "resource_citation": "Darvill (2019). Insight into the | ||
928 | Waterbirds of Lake Windermere. Prepared for Lake Windermere | 930 | Waterbirds of Lake Windermere. Prepared for Lake Windermere | ||
929 | Ambassadors. Columbia Basin Water Hub (Resource).\u00a0 Parson. | 931 | Ambassadors. Columbia Basin Water Hub (Resource).\u00a0 Parson. | ||
930 | (DOI)", | 932 | (DOI)", | ||
931 | "resource_data_disclaimer": "No warranty or guarantee exists | 933 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
932 | that the information is accurate, complete, current, or suitable for | 934 | that the information is accurate, complete, current, or suitable for | ||
933 | any purpose. The individual user must confirm the accuracy of the data | 935 | any purpose. The individual user must confirm the accuracy of the data | ||
934 | and whether it will be appropriate for their purpose.", | 936 | and whether it will be appropriate for their purpose.", | ||
935 | "resource_location": "Lake Windermere", | 937 | "resource_location": "Lake Windermere", | ||
936 | "resource_type": null, | 938 | "resource_type": null, | ||
937 | "size": 2009958, | 939 | "size": 2009958, | ||
938 | "state": "active", | 940 | "state": "active", | ||
939 | "url": | 941 | "url": | ||
940 | lwa_darvill_report_insightintothewaterbirdsoflakewindermere_2019.pdf", | 942 | lwa_darvill_report_insightintothewaterbirdsoflakewindermere_2019.pdf", | ||
941 | "url_type": "upload", | 943 | "url_type": "upload", | ||
942 | "waterhub_certified": "Certified", | 944 | "waterhub_certified": "Certified", | ||
943 | "waterhub_grade": "People and Perspectives" | 945 | "waterhub_grade": "People and Perspectives" | ||
944 | } | 946 | } | ||
945 | ], | 947 | ], | ||
946 | "start_date": "2009-01-01", | 948 | "start_date": "2009-01-01", | ||
947 | "state": "active", | 949 | "state": "active", | ||
948 | "tags": [ | 950 | "tags": [ | ||
949 | { | 951 | { | ||
950 | "display_name": "Bacteriological", | 952 | "display_name": "Bacteriological", | ||
951 | "id": "b446598e-8ac4-4dce-8eed-3ab2d595aca7", | 953 | "id": "b446598e-8ac4-4dce-8eed-3ab2d595aca7", | ||
952 | "name": "Bacteriological", | 954 | "name": "Bacteriological", | ||
953 | "state": "active", | 955 | "state": "active", | ||
954 | "vocabulary_id": null | 956 | "vocabulary_id": null | ||
955 | }, | 957 | }, | ||
956 | { | 958 | { | ||
957 | "display_name": "CABIN", | 959 | "display_name": "CABIN", | ||
958 | "id": "476e5cf2-3801-40e8-9c73-dac2cedbaf7f", | 960 | "id": "476e5cf2-3801-40e8-9c73-dac2cedbaf7f", | ||
959 | "name": "CABIN", | 961 | "name": "CABIN", | ||
960 | "state": "active", | 962 | "state": "active", | ||
961 | "vocabulary_id": null | 963 | "vocabulary_id": null | ||
962 | }, | 964 | }, | ||
963 | { | 965 | { | ||
964 | "display_name": "Community-based monitoring", | 966 | "display_name": "Community-based monitoring", | ||
965 | "id": "9b75240a-5e54-43c9-9063-969983d065f6", | 967 | "id": "9b75240a-5e54-43c9-9063-969983d065f6", | ||
966 | "name": "Community-based monitoring", | 968 | "name": "Community-based monitoring", | ||
967 | "state": "active", | 969 | "state": "active", | ||
968 | "vocabulary_id": null | 970 | "vocabulary_id": null | ||
969 | }, | 971 | }, | ||
970 | { | 972 | { | ||
971 | "display_name": "Fish", | 973 | "display_name": "Fish", | ||
972 | "id": "e5dce2fc-ec9c-4a16-83b3-9b1d0f991c12", | 974 | "id": "e5dce2fc-ec9c-4a16-83b3-9b1d0f991c12", | ||
973 | "name": "Fish", | 975 | "name": "Fish", | ||
974 | "state": "active", | 976 | "state": "active", | ||
975 | "vocabulary_id": null | 977 | "vocabulary_id": null | ||
976 | }, | 978 | }, | ||
977 | { | 979 | { | ||
978 | "display_name": "Hydrology", | 980 | "display_name": "Hydrology", | ||
979 | "id": "eb52bf78-f171-4c0b-961b-c7a49fed2236", | 981 | "id": "eb52bf78-f171-4c0b-961b-c7a49fed2236", | ||
980 | "name": "Hydrology", | 982 | "name": "Hydrology", | ||
981 | "state": "active", | 983 | "state": "active", | ||
982 | "vocabulary_id": null | 984 | "vocabulary_id": null | ||
983 | }, | 985 | }, | ||
984 | { | 986 | { | ||
985 | "display_name": "Hydrometric", | 987 | "display_name": "Hydrometric", | ||
986 | "id": "ae588e2d-8628-4e7f-ad0a-2cbd38adfd76", | 988 | "id": "ae588e2d-8628-4e7f-ad0a-2cbd38adfd76", | ||
987 | "name": "Hydrometric", | 989 | "name": "Hydrometric", | ||
988 | "state": "active", | 990 | "state": "active", | ||
989 | "vocabulary_id": null | 991 | "vocabulary_id": null | ||
990 | }, | 992 | }, | ||
991 | { | 993 | { | ||
992 | "display_name": "Lake", | 994 | "display_name": "Lake", | ||
993 | "id": "66dc1292-41ac-45cf-a267-f0d5c8a31826", | 995 | "id": "66dc1292-41ac-45cf-a267-f0d5c8a31826", | ||
994 | "name": "Lake", | 996 | "name": "Lake", | ||
995 | "state": "active", | 997 | "state": "active", | ||
996 | "vocabulary_id": null | 998 | "vocabulary_id": null | ||
997 | }, | 999 | }, | ||
998 | { | 1000 | { | ||
999 | "display_name": "People and Perspectives", | 1001 | "display_name": "People and Perspectives", | ||
1000 | "id": "bce02f6f-d09f-4305-8e4e-bfeabaeb3a2c", | 1002 | "id": "bce02f6f-d09f-4305-8e4e-bfeabaeb3a2c", | ||
1001 | "name": "People and Perspectives", | 1003 | "name": "People and Perspectives", | ||
1002 | "state": "active", | 1004 | "state": "active", | ||
1003 | "vocabulary_id": null | 1005 | "vocabulary_id": null | ||
1004 | }, | 1006 | }, | ||
1005 | { | 1007 | { | ||
1006 | "display_name": "Sediment Analysis", | 1008 | "display_name": "Sediment Analysis", | ||
1007 | "id": "7bb5f9ef-401c-4112-8a32-4a31695a3e25", | 1009 | "id": "7bb5f9ef-401c-4112-8a32-4a31695a3e25", | ||
1008 | "name": "Sediment Analysis", | 1010 | "name": "Sediment Analysis", | ||
1009 | "state": "active", | 1011 | "state": "active", | ||
1010 | "vocabulary_id": null | 1012 | "vocabulary_id": null | ||
1011 | }, | 1013 | }, | ||
1012 | { | 1014 | { | ||
1013 | "display_name": "Stream", | 1015 | "display_name": "Stream", | ||
1014 | "id": "208421f0-ebb5-4b32-8111-2ff156803d73", | 1016 | "id": "208421f0-ebb5-4b32-8111-2ff156803d73", | ||
1015 | "name": "Stream", | 1017 | "name": "Stream", | ||
1016 | "state": "active", | 1018 | "state": "active", | ||
1017 | "vocabulary_id": null | 1019 | "vocabulary_id": null | ||
1018 | }, | 1020 | }, | ||
1019 | { | 1021 | { | ||
1020 | "display_name": "Water Quality", | 1022 | "display_name": "Water Quality", | ||
1021 | "id": "12fe3ab5-fdaf-44c5-8167-06c7589d90f3", | 1023 | "id": "12fe3ab5-fdaf-44c5-8167-06c7589d90f3", | ||
1022 | "name": "Water Quality", | 1024 | "name": "Water Quality", | ||
1023 | "state": "active", | 1025 | "state": "active", | ||
1024 | "vocabulary_id": null | 1026 | "vocabulary_id": null | ||
1025 | }, | 1027 | }, | ||
1026 | { | 1028 | { | ||
1027 | "display_name": "Water temperature", | 1029 | "display_name": "Water temperature", | ||
1028 | "id": "0770347d-73eb-4f60-a661-50199f7049c3", | 1030 | "id": "0770347d-73eb-4f60-a661-50199f7049c3", | ||
1029 | "name": "Water temperature", | 1031 | "name": "Water temperature", | ||
1030 | "state": "active", | 1032 | "state": "active", | ||
1031 | "vocabulary_id": null | 1033 | "vocabulary_id": null | ||
1032 | } | 1034 | } | ||
1033 | ], | 1035 | ], | ||
1034 | "title": "Lake Windermere Ambassadors Annual Water Monitoring | 1036 | "title": "Lake Windermere Ambassadors Annual Water Monitoring | ||
1035 | Reports", | 1037 | Reports", | ||
1036 | "type": "dataset", | 1038 | "type": "dataset", | ||
1037 | "url": null, | 1039 | "url": null, | ||
1038 | "version": null | 1040 | "version": null | ||
1039 | } | 1041 | } |