Changes
On May 12, 2022 at 3:25:45 PM UTC, verenashaw-6471:
-
Changed value of field
resource_citation
of resource Insight into the Waterbirds of Lake Windermere toDarvill (2019). Insight into the Waterbirds of Lake Windermere. Prepared for Lake Windermere Ambassadors. Columbia Basin Water Hub (Resource). Parson. (DOI)
(previouslyDarvill. (2019). Insight into the Waterbirds of Lake Windermere. Prepared for Lake Windermere Ambassadors. Columbia Basin Water Hub [Resource]. Parson. https://doi.org/10.48511/KBGB-DJ25
) in Lake Windermere Ambassadors Annual Water Monitoring Reports
f | 1 | { | f | 1 | { |
2 | "author": null, | 2 | "author": null, | ||
3 | "author_email": null, | 3 | "author_email": null, | ||
4 | "citation": "Lake Windermere Ambassadors. (2021). Lake Windermere | 4 | "citation": "Lake Windermere Ambassadors. (2021). Lake Windermere | ||
5 | Ambassadors Annual Water Monitoring Reports [Data set]. Columbia Basin | 5 | Ambassadors Annual Water Monitoring Reports [Data set]. Columbia Basin | ||
6 | Water Hub. https://doi.org/10.48511/KBGB-DJ25", | 6 | Water Hub. https://doi.org/10.48511/KBGB-DJ25", | ||
7 | "creator": "Lake Windermere Ambassadors", | 7 | "creator": "Lake Windermere Ambassadors", | ||
8 | "creator_user_id": "efbb05c2-ed3c-42ec-894b-cafbb9d5f2db", | 8 | "creator_user_id": "efbb05c2-ed3c-42ec-894b-cafbb9d5f2db", | ||
9 | "data_disclaimer": "No warranty or guarantee exists that the | 9 | "data_disclaimer": "No warranty or guarantee exists that the | ||
10 | information is accurate, complete, current, or suitable for any | 10 | information is accurate, complete, current, or suitable for any | ||
11 | purpose. The individual user must confirm the accuracy of the data and | 11 | purpose. The individual user must confirm the accuracy of the data and | ||
12 | whether it will be appropriate for their purpose.", | 12 | whether it will be appropriate for their purpose.", | ||
13 | "data_type": "Lake", | 13 | "data_type": "Lake", | ||
14 | "end_date": "2020-12-31", | 14 | "end_date": "2020-12-31", | ||
15 | "funding_reference": "See individual reporots for funding | 15 | "funding_reference": "See individual reporots for funding | ||
16 | description.", | 16 | description.", | ||
17 | "groups": [ | 17 | "groups": [ | ||
18 | { | 18 | { | ||
19 | "description": "This group includes all the datasets which fall | 19 | "description": "This group includes all the datasets which fall | ||
20 | within the Columbia-Kootenay Headwaters Hydrologic region ", | 20 | within the Columbia-Kootenay Headwaters Hydrologic region ", | ||
21 | "display_name": "Columbia-Kootenay Headwaters", | 21 | "display_name": "Columbia-Kootenay Headwaters", | ||
22 | "id": "20673d8f-8f40-4e64-9f34-4966d5123705", | 22 | "id": "20673d8f-8f40-4e64-9f34-4966d5123705", | ||
23 | "image_display_url": | 23 | "image_display_url": | ||
24 | rhub.ca/uploads/group/2021-03-02-214610.209659Mapfinalheadwayers.png", | 24 | rhub.ca/uploads/group/2021-03-02-214610.209659Mapfinalheadwayers.png", | ||
25 | "name": "columbia-kootenay-headwaters", | 25 | "name": "columbia-kootenay-headwaters", | ||
26 | "title": "Columbia-Kootenay Headwaters" | 26 | "title": "Columbia-Kootenay Headwaters" | ||
27 | } | 27 | } | ||
28 | ], | 28 | ], | ||
29 | "id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 29 | "id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
30 | "identifier": "10.48511/KBGB-DJ25", | 30 | "identifier": "10.48511/KBGB-DJ25", | ||
31 | "isopen": false, | 31 | "isopen": false, | ||
32 | "keywords": "Community-based | 32 | "keywords": "Community-based | ||
33 | monitoring,Hydrology,Hydrometric,Fish,Lake,People and | 33 | monitoring,Hydrology,Hydrometric,Fish,Lake,People and | ||
34 | Perspectives,Water Quality,Stream,Water temperature,Sediment | 34 | Perspectives,Water Quality,Stream,Water temperature,Sediment | ||
35 | Analysis,Bacteriological,CABIN", | 35 | Analysis,Bacteriological,CABIN", | ||
36 | "latitude": "50.472805", | 36 | "latitude": "50.472805", | ||
37 | "license_id": "CC-BY-SA-4.0", | 37 | "license_id": "CC-BY-SA-4.0", | ||
38 | "license_title": "CC-BY-SA-4.0", | 38 | "license_title": "CC-BY-SA-4.0", | ||
39 | "location": "Lake Windermere, Windermere Creek", | 39 | "location": "Lake Windermere, Windermere Creek", | ||
40 | "longitude": "-116.019217", | 40 | "longitude": "-116.019217", | ||
41 | "maintainer": null, | 41 | "maintainer": null, | ||
42 | "maintainer_email": "cbwaterhub@livinglakescanada.ca", | 42 | "maintainer_email": "cbwaterhub@livinglakescanada.ca", | ||
43 | "metadata_created": "2021-11-23T21:03:29.640876", | 43 | "metadata_created": "2021-11-23T21:03:29.640876", | ||
n | 44 | "metadata_modified": "2022-05-12T15:25:38.503589", | n | 44 | "metadata_modified": "2022-05-12T15:25:45.745426", |
45 | "name": | 45 | "name": | ||
46 | "lake-windermere-ambassadors-annual-water-monitoring-reports", | 46 | "lake-windermere-ambassadors-annual-water-monitoring-reports", | ||
47 | "notes": "Included are the annual water monitoring reports from Lake | 47 | "notes": "Included are the annual water monitoring reports from Lake | ||
48 | Windermere and Windermere Creek as well as aquatic invasive plant | 48 | Windermere and Windermere Creek as well as aquatic invasive plant | ||
49 | reports and a report on Lake Windermere water birds.", | 49 | reports and a report on Lake Windermere water birds.", | ||
50 | "num_resources": 18, | 50 | "num_resources": 18, | ||
51 | "num_tags": 12, | 51 | "num_tags": 12, | ||
52 | "organization": { | 52 | "organization": { | ||
53 | "approval_status": "approved", | 53 | "approval_status": "approved", | ||
54 | "created": "2021-05-20T09:58:43.376117", | 54 | "created": "2021-05-20T09:58:43.376117", | ||
55 | "description": "The Lake Windermere Ambassadors are a | 55 | "description": "The Lake Windermere Ambassadors are a | ||
56 | community-based environmental stewardship non-profit working in the | 56 | community-based environmental stewardship non-profit working in the | ||
57 | East Kootenay region of BC. The Ambassadors have a vision of an | 57 | East Kootenay region of BC. The Ambassadors have a vision of an | ||
58 | ecologically healthy Lake Windermere with balanced management | 58 | ecologically healthy Lake Windermere with balanced management | ||
59 | approaches that support recreation and traditional uses, high fish and | 59 | approaches that support recreation and traditional uses, high fish and | ||
60 | wildlife values, and economic prosperity in the region.", | 60 | wildlife values, and economic prosperity in the region.", | ||
61 | "id": "fa6d1422-26e0-4d81-9abc-94f8fb043e7c", | 61 | "id": "fa6d1422-26e0-4d81-9abc-94f8fb043e7c", | ||
62 | "image_url": "2021-05-20-174743.524491Master-Large.png", | 62 | "image_url": "2021-05-20-174743.524491Master-Large.png", | ||
63 | "is_organization": true, | 63 | "is_organization": true, | ||
64 | "name": "lake-windermere", | 64 | "name": "lake-windermere", | ||
65 | "state": "active", | 65 | "state": "active", | ||
66 | "title": "Lake Windermere Ambassadors", | 66 | "title": "Lake Windermere Ambassadors", | ||
67 | "type": "organization" | 67 | "type": "organization" | ||
68 | }, | 68 | }, | ||
69 | "other_sources": "n/a", | 69 | "other_sources": "n/a", | ||
70 | "owner_org": "fa6d1422-26e0-4d81-9abc-94f8fb043e7c", | 70 | "owner_org": "fa6d1422-26e0-4d81-9abc-94f8fb043e7c", | ||
71 | "private": false, | 71 | "private": false, | ||
72 | "publication_year": "2021", | 72 | "publication_year": "2021", | ||
73 | "relationships_as_object": [], | 73 | "relationships_as_object": [], | ||
74 | "relationships_as_subject": [], | 74 | "relationships_as_subject": [], | ||
75 | "resources": [ | 75 | "resources": [ | ||
76 | { | 76 | { | ||
77 | "cache_last_updated": null, | 77 | "cache_last_updated": null, | ||
78 | "cache_url": null, | 78 | "cache_url": null, | ||
79 | "created": "2021-11-23T21:14:26.266170", | 79 | "created": "2021-11-23T21:14:26.266170", | ||
80 | "data_collection_info": "N/A", | 80 | "data_collection_info": "N/A", | ||
81 | "data_processing": "N/A", | 81 | "data_processing": "N/A", | ||
82 | "datastore_active": false, | 82 | "datastore_active": false, | ||
83 | "datastore_status": "", | 83 | "datastore_status": "", | ||
84 | "description": "In 2020, the Lake Windermere Ambassadors | 84 | "description": "In 2020, the Lake Windermere Ambassadors | ||
85 | collected physical and chemical water quality parameters at three | 85 | collected physical and chemical water quality parameters at three | ||
86 | sample sites on Lake Windermere once weekly during the summer, from | 86 | sample sites on Lake Windermere once weekly during the summer, from | ||
87 | late May to September\u200b. The lake sampling regime included water | 87 | late May to September\u200b. The lake sampling regime included water | ||
88 | temperature, turbidity/clarity, pH, conductivity, depth, and dissolved | 88 | temperature, turbidity/clarity, pH, conductivity, depth, and dissolved | ||
89 | oxygen. Once monthly from May to September we collected Total | 89 | oxygen. Once monthly from May to September we collected Total | ||
90 | Dissolved Phosphorus and Total Phosphorous. The LWA monitored | 90 | Dissolved Phosphorus and Total Phosphorous. The LWA monitored | ||
91 | substrate samplers at six sites on the east side of Lake Windermere | 91 | substrate samplers at six sites on the east side of Lake Windermere | ||
92 | for invasive mussels, and monitored tributary flows and water quality | 92 | for invasive mussels, and monitored tributary flows and water quality | ||
93 | at the outlet of Windermere Creek and Abel Creek. \u200bE. coli data | 93 | at the outlet of Windermere Creek and Abel Creek. \u200bE. coli data | ||
94 | was collected at public swim beaches weekly, from May until September, | 94 | was collected at public swim beaches weekly, from May until September, | ||
95 | excluding weeks with a statutory holiday Monday, in partnership with | 95 | excluding weeks with a statutory holiday Monday, in partnership with | ||
96 | the Interior Health Authority.", | 96 | the Interior Health Authority.", | ||
97 | "format": "PDF", | 97 | "format": "PDF", | ||
98 | "hash": "e7a7c3e18b245292c6e847bb9235bbac", | 98 | "hash": "e7a7c3e18b245292c6e847bb9235bbac", | ||
99 | "header_row": "", | 99 | "header_row": "", | ||
100 | "id": "1e59877d-72a2-4fed-bd21-9d613c0e53a5", | 100 | "id": "1e59877d-72a2-4fed-bd21-9d613c0e53a5", | ||
101 | "last_modified": "2021-11-23T21:14:26.212715", | 101 | "last_modified": "2021-11-23T21:14:26.212715", | ||
102 | "load_status": "", | 102 | "load_status": "", | ||
103 | "metadata_modified": "2022-05-12T14:36:53.412360", | 103 | "metadata_modified": "2022-05-12T14:36:53.412360", | ||
104 | "mimetype": "application/pdf", | 104 | "mimetype": "application/pdf", | ||
105 | "mimetype_inner": null, | 105 | "mimetype_inner": null, | ||
106 | "name": "Water Quality Monitoring Program 2020 Final Report", | 106 | "name": "Water Quality Monitoring Program 2020 Final Report", | ||
107 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 107 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
108 | "position": 0, | 108 | "position": 0, | ||
109 | "resource_citation": "Peck, G. (2021). Lake Windermere Community | 109 | "resource_citation": "Peck, G. (2021). Lake Windermere Community | ||
110 | Based Water Quality Monitoring Program 2020 Final Report. Prepared for | 110 | Based Water Quality Monitoring Program 2020 Final Report. Prepared for | ||
111 | Lake Windermere Ambassadors. Columbia Basin Water Hub. [Resource]. | 111 | Lake Windermere Ambassadors. Columbia Basin Water Hub. [Resource]. | ||
112 | Invermere. https://doi.org/10.48511/KBGB-DJ25", | 112 | Invermere. https://doi.org/10.48511/KBGB-DJ25", | ||
113 | "resource_data_disclaimer": "No warranty or guarantee exists | 113 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
114 | that the information is accurate, complete, current, or suitable for | 114 | that the information is accurate, complete, current, or suitable for | ||
115 | any purpose. The individual user must confirm the accuracy of the data | 115 | any purpose. The individual user must confirm the accuracy of the data | ||
116 | and whether it will be appropriate for their purpose.", | 116 | and whether it will be appropriate for their purpose.", | ||
117 | "resource_location": "Lake Windermere", | 117 | "resource_location": "Lake Windermere", | ||
118 | "resource_type": null, | 118 | "resource_type": null, | ||
119 | "size": 1595807, | 119 | "size": 1595807, | ||
120 | "state": "active", | 120 | "state": "active", | ||
121 | "url": | 121 | "url": | ||
122 | d/lwa_peck_report_lkwindermerewaterqualitymonitoringprogram_2020.pdf", | 122 | d/lwa_peck_report_lkwindermerewaterqualitymonitoringprogram_2020.pdf", | ||
123 | "url_type": "upload", | 123 | "url_type": "upload", | ||
124 | "waterhub_certified": "Certified", | 124 | "waterhub_certified": "Certified", | ||
125 | "waterhub_grade": "People and Perspectives" | 125 | "waterhub_grade": "People and Perspectives" | ||
126 | }, | 126 | }, | ||
127 | { | 127 | { | ||
128 | "cache_last_updated": null, | 128 | "cache_last_updated": null, | ||
129 | "cache_url": null, | 129 | "cache_url": null, | ||
130 | "created": "2021-11-23T21:55:51.837852", | 130 | "created": "2021-11-23T21:55:51.837852", | ||
131 | "data_collection_info": "n/a", | 131 | "data_collection_info": "n/a", | ||
132 | "data_processing": "n/a", | 132 | "data_processing": "n/a", | ||
133 | "datastore_active": false, | 133 | "datastore_active": false, | ||
134 | "datastore_status": "", | 134 | "datastore_status": "", | ||
135 | "description": "In 2019, the Lake Windermere Ambassadors | 135 | "description": "In 2019, the Lake Windermere Ambassadors | ||
136 | collected physical and chemical water quality parameters at three | 136 | collected physical and chemical water quality parameters at three | ||
137 | sample sites on Lake Windermere once weekly during the summer, from | 137 | sample sites on Lake Windermere once weekly during the summer, from | ||
138 | late May to September. The lake sampling regime included water | 138 | late May to September. The lake sampling regime included water | ||
139 | temperature, turbidity/clarity, pH, conductivity, depth, and dissolved | 139 | temperature, turbidity/clarity, pH, conductivity, depth, and dissolved | ||
140 | oxygen. Once monthly from May to September we collected Total | 140 | oxygen. Once monthly from May to September we collected Total | ||
141 | Dissolved Phosphorus and Total Phosphorous. In addition, the LWA | 141 | Dissolved Phosphorus and Total Phosphorous. In addition, the LWA | ||
142 | monitored substrate samplers at six sites on the east side of Lake | 142 | monitored substrate samplers at six sites on the east side of Lake | ||
143 | Windermere for invasive mussels, as well as monitoring tributary flows | 143 | Windermere for invasive mussels, as well as monitoring tributary flows | ||
144 | and water quality at the outlet of Windermere Creek and Abel Creek. E. | 144 | and water quality at the outlet of Windermere Creek and Abel Creek. E. | ||
145 | coli data was collected at public swim beaches weekly, from May until | 145 | coli data was collected at public swim beaches weekly, from May until | ||
146 | September, excluding weeks with a statutory holiday Monday, in | 146 | September, excluding weeks with a statutory holiday Monday, in | ||
147 | partnership with the Interior Health Authority. Lastly, Goldeneye | 147 | partnership with the Interior Health Authority. Lastly, Goldeneye | ||
148 | Ecological Services was contracted to complete an aquatic plant | 148 | Ecological Services was contracted to complete an aquatic plant | ||
149 | survey, and fall waterbird survey on Lake Windermere.", | 149 | survey, and fall waterbird survey on Lake Windermere.", | ||
150 | "format": "PDF", | 150 | "format": "PDF", | ||
151 | "hash": "3d388a54d7dc9fef6df16bd80732492f", | 151 | "hash": "3d388a54d7dc9fef6df16bd80732492f", | ||
152 | "header_row": "", | 152 | "header_row": "", | ||
153 | "id": "d9db0064-520b-4e59-a537-4164219cb5bf", | 153 | "id": "d9db0064-520b-4e59-a537-4164219cb5bf", | ||
154 | "last_modified": "2021-11-23T21:55:51.776932", | 154 | "last_modified": "2021-11-23T21:55:51.776932", | ||
155 | "load_status": "", | 155 | "load_status": "", | ||
156 | "metadata_modified": "2022-05-12T14:56:21.447132", | 156 | "metadata_modified": "2022-05-12T14:56:21.447132", | ||
157 | "mimetype": "application/pdf", | 157 | "mimetype": "application/pdf", | ||
158 | "mimetype_inner": null, | 158 | "mimetype_inner": null, | ||
159 | "name": "Water Quality Monitoring Program 2019 Final Report", | 159 | "name": "Water Quality Monitoring Program 2019 Final Report", | ||
160 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 160 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
161 | "position": 1, | 161 | "position": 1, | ||
162 | "resource_citation": "McGinty. (2019). Lake Windermere Community | 162 | "resource_citation": "McGinty. (2019). Lake Windermere Community | ||
163 | Based Water Quality Monitoring Program 2019 Final Report. Prepared for | 163 | Based Water Quality Monitoring Program 2019 Final Report. Prepared for | ||
164 | Lake Windermere Ambassadors. Columbia Basin Water Hub | 164 | Lake Windermere Ambassadors. Columbia Basin Water Hub | ||
165 | [Resource].\u00a0 Invermere. https://doi.org/10.48511/KBGB-DJ25", | 165 | [Resource].\u00a0 Invermere. https://doi.org/10.48511/KBGB-DJ25", | ||
166 | "resource_data_disclaimer": "No warranty or guarantee exists | 166 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
167 | that the information is accurate, complete, current, or suitable for | 167 | that the information is accurate, complete, current, or suitable for | ||
168 | any purpose. The individual user must confirm the accuracy of the data | 168 | any purpose. The individual user must confirm the accuracy of the data | ||
169 | and whether it will be appropriate for their purpose.", | 169 | and whether it will be appropriate for their purpose.", | ||
170 | "resource_location": "Lake Windermere", | 170 | "resource_location": "Lake Windermere", | ||
171 | "resource_type": null, | 171 | "resource_type": null, | ||
172 | "size": 2320463, | 172 | "size": 2320463, | ||
173 | "state": "active", | 173 | "state": "active", | ||
174 | "url": | 174 | "url": | ||
175 | wa_mcginty_report_lkwindermerewaterqualitymonitoringprogram_2019.pdf", | 175 | wa_mcginty_report_lkwindermerewaterqualitymonitoringprogram_2019.pdf", | ||
176 | "url_type": "upload", | 176 | "url_type": "upload", | ||
177 | "waterhub_certified": "Certified", | 177 | "waterhub_certified": "Certified", | ||
178 | "waterhub_grade": "People and Perspectives" | 178 | "waterhub_grade": "People and Perspectives" | ||
179 | }, | 179 | }, | ||
180 | { | 180 | { | ||
181 | "cache_last_updated": null, | 181 | "cache_last_updated": null, | ||
182 | "cache_url": null, | 182 | "cache_url": null, | ||
183 | "created": "2021-11-23T22:24:53.420732", | 183 | "created": "2021-11-23T22:24:53.420732", | ||
184 | "data_collection_info": "n/a", | 184 | "data_collection_info": "n/a", | ||
185 | "data_processing": "n/a", | 185 | "data_processing": "n/a", | ||
186 | "datastore_active": false, | 186 | "datastore_active": false, | ||
187 | "datastore_status": "", | 187 | "datastore_status": "", | ||
188 | "description": "In 2018, the LWA collected physical and chemical | 188 | "description": "In 2018, the LWA collected physical and chemical | ||
189 | water quality parameters at three sample sites on Lake Windermere. | 189 | water quality parameters at three sample sites on Lake Windermere. | ||
190 | Once weekly during the summer from late May to mid-September, the lake | 190 | Once weekly during the summer from late May to mid-September, the lake | ||
191 | sampling regime included: water temperature, turbidity/clarity, pH, | 191 | sampling regime included: water temperature, turbidity/clarity, pH, | ||
192 | conductivity, depth, and dissolved oxygen. Once monthly from April to | 192 | conductivity, depth, and dissolved oxygen. Once monthly from April to | ||
193 | August, we collected samples for Total and Total Dissolved | 193 | August, we collected samples for Total and Total Dissolved | ||
194 | Phosphorous. The LWA also collected E. coli data at public swim | 194 | Phosphorous. The LWA also collected E. coli data at public swim | ||
195 | beaches in partnership with the Interior Health Authority, and | 195 | beaches in partnership with the Interior Health Authority, and | ||
196 | monitored tributary flows and water quality at the outlet of | 196 | monitored tributary flows and water quality at the outlet of | ||
197 | Windermere Creek and Abel Creek. Lastly, we conducted an aquatic plant | 197 | Windermere Creek and Abel Creek. Lastly, we conducted an aquatic plant | ||
198 | survey as well as a fall waterbird survey on Lake Windermere with the | 198 | survey as well as a fall waterbird survey on Lake Windermere with the | ||
199 | help and expertise of Goldeneye Ecological Services.\r\n", | 199 | help and expertise of Goldeneye Ecological Services.\r\n", | ||
200 | "format": "PDF", | 200 | "format": "PDF", | ||
201 | "hash": "7a5d9b8bb4af9de2305cffe8928edd30", | 201 | "hash": "7a5d9b8bb4af9de2305cffe8928edd30", | ||
202 | "header_row": "", | 202 | "header_row": "", | ||
203 | "id": "aa6c989d-266e-4f8c-a666-fed3782c1cb1", | 203 | "id": "aa6c989d-266e-4f8c-a666-fed3782c1cb1", | ||
204 | "last_modified": "2021-11-23T22:24:53.353134", | 204 | "last_modified": "2021-11-23T22:24:53.353134", | ||
205 | "load_status": "", | 205 | "load_status": "", | ||
206 | "metadata_modified": "2022-05-12T15:01:04.773346", | 206 | "metadata_modified": "2022-05-12T15:01:04.773346", | ||
207 | "mimetype": "application/pdf", | 207 | "mimetype": "application/pdf", | ||
208 | "mimetype_inner": null, | 208 | "mimetype_inner": null, | ||
209 | "name": "Water Quality Monitoring Program 2018 Final Report", | 209 | "name": "Water Quality Monitoring Program 2018 Final Report", | ||
210 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 210 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
211 | "position": 2, | 211 | "position": 2, | ||
212 | "resource_citation": "Rodgers. (2018). Lake Windermere | 212 | "resource_citation": "Rodgers. (2018). Lake Windermere | ||
213 | Community-Based Water Quality Monitoring Program 2018 Final Report. | 213 | Community-Based Water Quality Monitoring Program 2018 Final Report. | ||
214 | Prepared for Lake Windermere Ambassadors. Columbia Basin Water Hub. | 214 | Prepared for Lake Windermere Ambassadors. Columbia Basin Water Hub. | ||
215 | [Resource]. Invermere. https://doi.org/10.48511/KBGB-DJ25", | 215 | [Resource]. Invermere. https://doi.org/10.48511/KBGB-DJ25", | ||
216 | "resource_data_disclaimer": "No warranty or guarantee exists | 216 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
217 | that the information is accurate, complete, current, or suitable for | 217 | that the information is accurate, complete, current, or suitable for | ||
218 | any purpose. The individual user must confirm the accuracy of the data | 218 | any purpose. The individual user must confirm the accuracy of the data | ||
219 | and whether it will be appropriate for their purpose.", | 219 | and whether it will be appropriate for their purpose.", | ||
220 | "resource_location": "Lake Windermere", | 220 | "resource_location": "Lake Windermere", | ||
221 | "resource_type": null, | 221 | "resource_type": null, | ||
222 | "size": 2382873, | 222 | "size": 2382873, | ||
223 | "state": "active", | 223 | "state": "active", | ||
224 | "url": | 224 | "url": | ||
225 | rt_lkwindermerecommunity-basedwaterqualitymonitoringprogram_2018.pdf", | 225 | rt_lkwindermerecommunity-basedwaterqualitymonitoringprogram_2018.pdf", | ||
226 | "url_type": "upload", | 226 | "url_type": "upload", | ||
227 | "waterhub_certified": "Certified", | 227 | "waterhub_certified": "Certified", | ||
228 | "waterhub_grade": "People and Perspectives" | 228 | "waterhub_grade": "People and Perspectives" | ||
229 | }, | 229 | }, | ||
230 | { | 230 | { | ||
231 | "cache_last_updated": null, | 231 | "cache_last_updated": null, | ||
232 | "cache_url": null, | 232 | "cache_url": null, | ||
233 | "created": "2021-11-23T22:37:40.342909", | 233 | "created": "2021-11-23T22:37:40.342909", | ||
234 | "data_collection_info": "n/a", | 234 | "data_collection_info": "n/a", | ||
235 | "data_processing": "n/a", | 235 | "data_processing": "n/a", | ||
236 | "datastore_active": false, | 236 | "datastore_active": false, | ||
237 | "datastore_status": "", | 237 | "datastore_status": "", | ||
238 | "description": "In 2017, the LWA collected physical and chemical | 238 | "description": "In 2017, the LWA collected physical and chemical | ||
239 | water quality parameters at three sample sites on Lake Windermere. | 239 | water quality parameters at three sample sites on Lake Windermere. | ||
240 | Once weekly during the summer from mid-June to mid-September, the lake | 240 | Once weekly during the summer from mid-June to mid-September, the lake | ||
241 | sampling regime included: temperature, turbidity/clarity, pH, | 241 | sampling regime included: temperature, turbidity/clarity, pH, | ||
242 | conductivity, depth, dissolved oxygen, and Total and Dissolved | 242 | conductivity, depth, dissolved oxygen, and Total and Dissolved | ||
243 | Phosphorous. The LWA also collected E. coli data at public swim | 243 | Phosphorous. The LWA also collected E. coli data at public swim | ||
244 | beaches with the support of the Interior Health Authority, and | 244 | beaches with the support of the Interior Health Authority, and | ||
245 | monitored tributary flows and water quality at the outlet of | 245 | monitored tributary flows and water quality at the outlet of | ||
246 | Windermere Creek with the support of the Columbia Basin Water Quality | 246 | Windermere Creek with the support of the Columbia Basin Water Quality | ||
247 | Monitoring Project (CBWQ). Finally, we conducted an aquatic plant and | 247 | Monitoring Project (CBWQ). Finally, we conducted an aquatic plant and | ||
248 | invasive veliger survey with the help and expertise of the East | 248 | invasive veliger survey with the help and expertise of the East | ||
249 | Kootenay Invasive Species Council and Goldeneye Ecological Services.", | 249 | Kootenay Invasive Species Council and Goldeneye Ecological Services.", | ||
250 | "format": "PDF", | 250 | "format": "PDF", | ||
251 | "hash": "", | 251 | "hash": "", | ||
252 | "header_row": "", | 252 | "header_row": "", | ||
253 | "id": "8d13ec2c-6a7b-4dab-bb00-ff525d787063", | 253 | "id": "8d13ec2c-6a7b-4dab-bb00-ff525d787063", | ||
254 | "last_modified": null, | 254 | "last_modified": null, | ||
255 | "load_status": "", | 255 | "load_status": "", | ||
256 | "metadata_modified": "2022-05-12T15:02:25.990121", | 256 | "metadata_modified": "2022-05-12T15:02:25.990121", | ||
257 | "mimetype": null, | 257 | "mimetype": null, | ||
258 | "mimetype_inner": null, | 258 | "mimetype_inner": null, | ||
259 | "name": "Lake Windermere 2017 Water Quality Monitoring Results", | 259 | "name": "Lake Windermere 2017 Water Quality Monitoring Results", | ||
260 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 260 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
261 | "position": 3, | 261 | "position": 3, | ||
262 | "resource_citation": "Rodgers. (2017). Lake Windermere 2017 | 262 | "resource_citation": "Rodgers. (2017). Lake Windermere 2017 | ||
263 | Water Quality Monitoring Results. Prepared for Lake Windermere | 263 | Water Quality Monitoring Results. Prepared for Lake Windermere | ||
264 | Ambassadors. Columbia Basin Water Hub [Resource].\u00a0Invermere | 264 | Ambassadors. Columbia Basin Water Hub [Resource].\u00a0Invermere | ||
265 | https://doi.org/10.48511/KBGB-DJ25", | 265 | https://doi.org/10.48511/KBGB-DJ25", | ||
266 | "resource_data_disclaimer": "No warranty or guarantee exists | 266 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
267 | that the information is accurate, complete, current, or suitable for | 267 | that the information is accurate, complete, current, or suitable for | ||
268 | any purpose. The individual user must confirm the accuracy of the data | 268 | any purpose. The individual user must confirm the accuracy of the data | ||
269 | and whether it will be appropriate for their purpose.", | 269 | and whether it will be appropriate for their purpose.", | ||
270 | "resource_location": "Lake Windermere", | 270 | "resource_location": "Lake Windermere", | ||
271 | "resource_type": null, | 271 | "resource_type": null, | ||
272 | "size": null, | 272 | "size": null, | ||
273 | "state": "active", | 273 | "state": "active", | ||
274 | "url": "", | 274 | "url": "", | ||
275 | "url_type": null, | 275 | "url_type": null, | ||
276 | "waterhub_certified": "Certified", | 276 | "waterhub_certified": "Certified", | ||
277 | "waterhub_grade": "People and Perspectives" | 277 | "waterhub_grade": "People and Perspectives" | ||
278 | }, | 278 | }, | ||
279 | { | 279 | { | ||
280 | "cache_last_updated": null, | 280 | "cache_last_updated": null, | ||
281 | "cache_url": null, | 281 | "cache_url": null, | ||
282 | "created": "2021-11-23T22:49:43.365126", | 282 | "created": "2021-11-23T22:49:43.365126", | ||
283 | "data_collection_info": "n/a", | 283 | "data_collection_info": "n/a", | ||
284 | "data_processing": "n/a", | 284 | "data_processing": "n/a", | ||
285 | "datastore_active": false, | 285 | "datastore_active": false, | ||
286 | "datastore_status": "", | 286 | "datastore_status": "", | ||
287 | "description": "2016 marked the eleventh year of lake monitoring | 287 | "description": "2016 marked the eleventh year of lake monitoring | ||
288 | since the Lake Windermere Project started data collection in 2006. The | 288 | since the Lake Windermere Project started data collection in 2006. The | ||
289 | spring and summer of 2014-2016 brought mild climatic conditions | 289 | spring and summer of 2014-2016 brought mild climatic conditions | ||
290 | without the major flooding events which characterized 2012-2013. | 290 | without the major flooding events which characterized 2012-2013. | ||
291 | Measured lake depths in 2016 were comparable to those in 2006-2008, | 291 | Measured lake depths in 2016 were comparable to those in 2006-2008, | ||
292 | and shallower than average levels in more recent years (2012, 2014). | 292 | and shallower than average levels in more recent years (2012, 2014). | ||
293 | Lake Windermere met Objectives for temperature, dissolved oxygen, and | 293 | Lake Windermere met Objectives for temperature, dissolved oxygen, and | ||
294 | turbidity throughout the summer. This means the water was clear, cool, | 294 | turbidity throughout the summer. This means the water was clear, cool, | ||
295 | and well oxygenated: all in line with historic levels. Beach | 295 | and well oxygenated: all in line with historic levels. Beach | ||
296 | monitoring results showed that shoreline bacteria levels did not | 296 | monitoring results showed that shoreline bacteria levels did not | ||
297 | exceed the recommended Guidelines for safe swimming on any of Lake | 297 | exceed the recommended Guidelines for safe swimming on any of Lake | ||
298 | Windermere\u2019s public beaches over the summer.", | 298 | Windermere\u2019s public beaches over the summer.", | ||
299 | "format": "PDF", | 299 | "format": "PDF", | ||
300 | "hash": "2273882fe388dc8ddcc3350075dccb34", | 300 | "hash": "2273882fe388dc8ddcc3350075dccb34", | ||
301 | "header_row": "", | 301 | "header_row": "", | ||
302 | "id": "f9919c08-5a37-4277-9c64-4fca6cb1e3ed", | 302 | "id": "f9919c08-5a37-4277-9c64-4fca6cb1e3ed", | ||
303 | "last_modified": "2021-11-23T22:49:43.289338", | 303 | "last_modified": "2021-11-23T22:49:43.289338", | ||
304 | "load_status": "", | 304 | "load_status": "", | ||
305 | "metadata_modified": "2022-05-12T15:05:19.631346", | 305 | "metadata_modified": "2022-05-12T15:05:19.631346", | ||
306 | "mimetype": "application/pdf", | 306 | "mimetype": "application/pdf", | ||
307 | "mimetype_inner": null, | 307 | "mimetype_inner": null, | ||
308 | "name": "Lake Windermere 2016 Water Quality Monitoring Results", | 308 | "name": "Lake Windermere 2016 Water Quality Monitoring Results", | ||
309 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 309 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
310 | "position": 4, | 310 | "position": 4, | ||
311 | "resource_citation": "Peloso. (2017). Lake Windermere 2016 Water | 311 | "resource_citation": "Peloso. (2017). Lake Windermere 2016 Water | ||
312 | Quality Monitoring Results. Prepared for Lake Windermere Ambassadors. | 312 | Quality Monitoring Results. Prepared for Lake Windermere Ambassadors. | ||
313 | Columbia Basin Water Hub [Resource].\u00a0Invermere. | 313 | Columbia Basin Water Hub [Resource].\u00a0Invermere. | ||
314 | https://doi.org/10.48511/KBGB-DJ25", | 314 | https://doi.org/10.48511/KBGB-DJ25", | ||
315 | "resource_data_disclaimer": "No warranty or guarantee exists | 315 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
316 | that the information is accurate, complete, current, or suitable for | 316 | that the information is accurate, complete, current, or suitable for | ||
317 | any purpose. The individual user must confirm the accuracy of the data | 317 | any purpose. The individual user must confirm the accuracy of the data | ||
318 | and whether it will be appropriate for their purpose.", | 318 | and whether it will be appropriate for their purpose.", | ||
319 | "resource_location": "Lake Windermere", | 319 | "resource_location": "Lake Windermere", | ||
320 | "resource_type": null, | 320 | "resource_type": null, | ||
321 | "size": 1299939, | 321 | "size": 1299939, | ||
322 | "state": "active", | 322 | "state": "active", | ||
323 | "url": | 323 | "url": | ||
324 | loso_report_lakewindermere2016waterqualitymonitoringresults_2016.pdf", | 324 | loso_report_lakewindermere2016waterqualitymonitoringresults_2016.pdf", | ||
325 | "url_type": "upload", | 325 | "url_type": "upload", | ||
326 | "waterhub_certified": "Certified", | 326 | "waterhub_certified": "Certified", | ||
327 | "waterhub_grade": "People and Perspectives" | 327 | "waterhub_grade": "People and Perspectives" | ||
328 | }, | 328 | }, | ||
329 | { | 329 | { | ||
330 | "cache_last_updated": null, | 330 | "cache_last_updated": null, | ||
331 | "cache_url": null, | 331 | "cache_url": null, | ||
332 | "created": "2021-11-23T23:05:34.834141", | 332 | "created": "2021-11-23T23:05:34.834141", | ||
333 | "data_collection_info": "n/a", | 333 | "data_collection_info": "n/a", | ||
334 | "data_processing": "n/a", | 334 | "data_processing": "n/a", | ||
335 | "datastore_active": false, | 335 | "datastore_active": false, | ||
336 | "datastore_status": "", | 336 | "datastore_status": "", | ||
337 | "description": "2015 marked the tenth year of lake monitoring | 337 | "description": "2015 marked the tenth year of lake monitoring | ||
338 | since the Lake Windermere Project started data collection in 2006. The | 338 | since the Lake Windermere Project started data collection in 2006. The | ||
339 | spring and summer of 2014 and 2015 brought mild climatic conditions | 339 | spring and summer of 2014 and 2015 brought mild climatic conditions | ||
340 | without the major flooding events which characterized 2012 and 2013. | 340 | without the major flooding events which characterized 2012 and 2013. | ||
341 | Measured lake depths in 2015 were comparable to those in 2006-2008, | 341 | Measured lake depths in 2015 were comparable to those in 2006-2008, | ||
342 | and shallower than average levels in more recent years (2012, 2014). | 342 | and shallower than average levels in more recent years (2012, 2014). | ||
343 | Lake Windermere met Objectives for temperature, dissolved oxygen, and | 343 | Lake Windermere met Objectives for temperature, dissolved oxygen, and | ||
344 | turbidity throughout the summer. This means the water was clear, cool, | 344 | turbidity throughout the summer. This means the water was clear, cool, | ||
345 | and well oxygenated: all in line with historic levels. Beach | 345 | and well oxygenated: all in line with historic levels. Beach | ||
346 | monitoring results show that shoreline bacteria levels did not exceed | 346 | monitoring results show that shoreline bacteria levels did not exceed | ||
347 | the recommended Guidelines for safe swimming on any of Lake | 347 | the recommended Guidelines for safe swimming on any of Lake | ||
348 | Windermere\u2019s public beaches over the summer.\r\nTotal phosphorus | 348 | Windermere\u2019s public beaches over the summer.\r\nTotal phosphorus | ||
349 | levels at ice-off exceeded the Objective for the Lake at two sampling | 349 | levels at ice-off exceeded the Objective for the Lake at two sampling | ||
350 | stations in 2015. A slight increasing trend in this nutrient has been | 350 | stations in 2015. A slight increasing trend in this nutrient has been | ||
351 | observed in the lake in recent years, warranting continued monitoring | 351 | observed in the lake in recent years, warranting continued monitoring | ||
352 | in conjunction with efforts on land to keep excess nutrients out of | 352 | in conjunction with efforts on land to keep excess nutrients out of | ||
353 | the lake.", | 353 | the lake.", | ||
354 | "format": "PDF", | 354 | "format": "PDF", | ||
355 | "hash": "0a33c447193b2f26f74036fde504639c", | 355 | "hash": "0a33c447193b2f26f74036fde504639c", | ||
356 | "header_row": "", | 356 | "header_row": "", | ||
357 | "id": "d27e444f-a734-4e40-bc8d-56fc4f3f4755", | 357 | "id": "d27e444f-a734-4e40-bc8d-56fc4f3f4755", | ||
358 | "last_modified": "2021-11-23T23:05:34.756954", | 358 | "last_modified": "2021-11-23T23:05:34.756954", | ||
359 | "load_status": "", | 359 | "load_status": "", | ||
360 | "metadata_modified": "2022-05-12T15:06:38.231833", | 360 | "metadata_modified": "2022-05-12T15:06:38.231833", | ||
361 | "mimetype": "application/pdf", | 361 | "mimetype": "application/pdf", | ||
362 | "mimetype_inner": null, | 362 | "mimetype_inner": null, | ||
363 | "name": "Lake Windermere 2015 Water Quality Monitoring Results", | 363 | "name": "Lake Windermere 2015 Water Quality Monitoring Results", | ||
364 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 364 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
365 | "position": 5, | 365 | "position": 5, | ||
366 | "resource_citation": "Peloso. (2016). Lake Windermere 2015 Water | 366 | "resource_citation": "Peloso. (2016). Lake Windermere 2015 Water | ||
367 | Quality Monitoring Results. Prepared for Lake Windermere Ambassadors. | 367 | Quality Monitoring Results. Prepared for Lake Windermere Ambassadors. | ||
368 | Columbia Basin Water Hub [Resource].\u00a0Invermere. | 368 | Columbia Basin Water Hub [Resource].\u00a0Invermere. | ||
369 | https://doi.org/10.48511/KBGB-DJ25", | 369 | https://doi.org/10.48511/KBGB-DJ25", | ||
370 | "resource_data_disclaimer": "No warranty or guarantee exists | 370 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
371 | that the information is accurate, complete, current, or suitable for | 371 | that the information is accurate, complete, current, or suitable for | ||
372 | any purpose. The individual user must confirm the accuracy of the data | 372 | any purpose. The individual user must confirm the accuracy of the data | ||
373 | and whether it will be appropriate for their purpose.", | 373 | and whether it will be appropriate for their purpose.", | ||
374 | "resource_location": "Lake Windermere", | 374 | "resource_location": "Lake Windermere", | ||
375 | "resource_type": null, | 375 | "resource_type": null, | ||
376 | "size": 1182081, | 376 | "size": 1182081, | ||
377 | "state": "active", | 377 | "state": "active", | ||
378 | "url": | 378 | "url": | ||
379 | peloso_report_lkwindermere2015waterqualitymonitoringresults_2015.pdf", | 379 | peloso_report_lkwindermere2015waterqualitymonitoringresults_2015.pdf", | ||
380 | "url_type": "upload", | 380 | "url_type": "upload", | ||
381 | "waterhub_certified": "Certified", | 381 | "waterhub_certified": "Certified", | ||
382 | "waterhub_grade": "People and Perspectives" | 382 | "waterhub_grade": "People and Perspectives" | ||
383 | }, | 383 | }, | ||
384 | { | 384 | { | ||
385 | "cache_last_updated": null, | 385 | "cache_last_updated": null, | ||
386 | "cache_url": null, | 386 | "cache_url": null, | ||
387 | "created": "2021-11-23T23:13:35.771622", | 387 | "created": "2021-11-23T23:13:35.771622", | ||
388 | "data_collection_info": "n/a", | 388 | "data_collection_info": "n/a", | ||
389 | "data_processing": "n/a", | 389 | "data_processing": "n/a", | ||
390 | "datastore_active": false, | 390 | "datastore_active": false, | ||
391 | "datastore_status": "", | 391 | "datastore_status": "", | ||
392 | "description": "The spring and summer of 2014 brought mild | 392 | "description": "The spring and summer of 2014 brought mild | ||
393 | climatic conditions without the major flooding events which | 393 | climatic conditions without the major flooding events which | ||
394 | characterized 2012 and 2013. The measured lake depths in 2014 were | 394 | characterized 2012 and 2013. The measured lake depths in 2014 were | ||
395 | comparable to those in 2012, and deeper than average levels between | 395 | comparable to those in 2012, and deeper than average levels between | ||
396 | 2006-2008 and 2011. Lake Windermere met Objectives for temperature, | 396 | 2006-2008 and 2011. Lake Windermere met Objectives for temperature, | ||
397 | dissolved oxygen, and turbidity throughout the summer. This means the | 397 | dissolved oxygen, and turbidity throughout the summer. This means the | ||
398 | water was clear, cool, and well oxygenated: all in line with historic | 398 | water was clear, cool, and well oxygenated: all in line with historic | ||
399 | levels. The beaches were clean in 2014. Measured beach bacteria levels | 399 | levels. The beaches were clean in 2014. Measured beach bacteria levels | ||
400 | did not exceed the recommended Guidelines for safe swimming on any of | 400 | did not exceed the recommended Guidelines for safe swimming on any of | ||
401 | the public beaches over the summer.\r\nTotal phosphorus levels | 401 | the public beaches over the summer.\r\nTotal phosphorus levels | ||
402 | exceeded the Objective for the Lake at one sampling station in 2014. A | 402 | exceeded the Objective for the Lake at one sampling station in 2014. A | ||
403 | slight increasing trend in this nutrient has been observed in the lake | 403 | slight increasing trend in this nutrient has been observed in the lake | ||
404 | in recent years, warranting close monitoring of this critical nutrient | 404 | in recent years, warranting close monitoring of this critical nutrient | ||
405 | and continued efforts on land to keep excess nutrients out of the | 405 | and continued efforts on land to keep excess nutrients out of the | ||
406 | lake.", | 406 | lake.", | ||
407 | "format": "PDF", | 407 | "format": "PDF", | ||
408 | "hash": "e334758dfd79acfeccd9491fa45c4147", | 408 | "hash": "e334758dfd79acfeccd9491fa45c4147", | ||
409 | "header_row": "", | 409 | "header_row": "", | ||
410 | "id": "7c715f2d-aeb5-416d-b153-98e7e9b6c60c", | 410 | "id": "7c715f2d-aeb5-416d-b153-98e7e9b6c60c", | ||
411 | "last_modified": "2021-12-08T21:32:37.277837", | 411 | "last_modified": "2021-12-08T21:32:37.277837", | ||
412 | "load_status": "", | 412 | "load_status": "", | ||
413 | "metadata_modified": "2022-05-12T15:09:00.444722", | 413 | "metadata_modified": "2022-05-12T15:09:00.444722", | ||
414 | "mimetype": "application/pdf", | 414 | "mimetype": "application/pdf", | ||
415 | "mimetype_inner": null, | 415 | "mimetype_inner": null, | ||
416 | "name": "Lake Windermere 2014 Water Quality Monitoring Results", | 416 | "name": "Lake Windermere 2014 Water Quality Monitoring Results", | ||
417 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 417 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
418 | "position": 6, | 418 | "position": 6, | ||
419 | "resource_citation": "Harma. (2014). Lake Windermere 2014 Water | 419 | "resource_citation": "Harma. (2014). Lake Windermere 2014 Water | ||
420 | Quality Monitoring Results. Prepared for Lake Windermere Ambassadors. | 420 | Quality Monitoring Results. Prepared for Lake Windermere Ambassadors. | ||
421 | Columbia Basin Water Hub [Resource].\u00a0Invermere. | 421 | Columbia Basin Water Hub [Resource].\u00a0Invermere. | ||
422 | https://doi.org/10.48511/KBGB-DJ25", | 422 | https://doi.org/10.48511/KBGB-DJ25", | ||
423 | "resource_data_disclaimer": "No warranty or guarantee exists | 423 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
424 | that the information is accurate, complete, current, or suitable for | 424 | that the information is accurate, complete, current, or suitable for | ||
425 | any purpose. The individual user must confirm the accuracy of the data | 425 | any purpose. The individual user must confirm the accuracy of the data | ||
426 | and whether it will be appropriate for their purpose.", | 426 | and whether it will be appropriate for their purpose.", | ||
427 | "resource_location": "Lake Windermere", | 427 | "resource_location": "Lake Windermere", | ||
428 | "resource_type": null, | 428 | "resource_type": null, | ||
429 | "size": 857404, | 429 | "size": 857404, | ||
430 | "state": "active", | 430 | "state": "active", | ||
431 | "url": | 431 | "url": | ||
432 | _harma_report_lkwindermere2014waterqualitymonitoringresults_2014.pdf", | 432 | _harma_report_lkwindermere2014waterqualitymonitoringresults_2014.pdf", | ||
433 | "url_type": "upload", | 433 | "url_type": "upload", | ||
434 | "waterhub_certified": "Certified", | 434 | "waterhub_certified": "Certified", | ||
435 | "waterhub_grade": "People and Perspectives" | 435 | "waterhub_grade": "People and Perspectives" | ||
436 | }, | 436 | }, | ||
437 | { | 437 | { | ||
438 | "cache_last_updated": null, | 438 | "cache_last_updated": null, | ||
439 | "cache_url": null, | 439 | "cache_url": null, | ||
440 | "created": "2021-11-23T23:20:00.004349", | 440 | "created": "2021-11-23T23:20:00.004349", | ||
441 | "data_collection_info": "n/a", | 441 | "data_collection_info": "n/a", | ||
442 | "data_processing": "n/a", | 442 | "data_processing": "n/a", | ||
443 | "datastore_active": false, | 443 | "datastore_active": false, | ||
444 | "datastore_status": "", | 444 | "datastore_status": "", | ||
445 | "description": "In 2013, Lake Windermere Ambassadors\u2019 | 445 | "description": "In 2013, Lake Windermere Ambassadors\u2019 | ||
446 | volunteers and staff sampled lake water at three locations monitored | 446 | volunteers and staff sampled lake water at three locations monitored | ||
447 | historically by the Ministry of Environment and then by the Lake | 447 | historically by the Ministry of Environment and then by the Lake | ||
448 | Windermere Project. The sites cover the North and South end and center | 448 | Windermere Project. The sites cover the North and South end and center | ||
449 | (Mid) of the lake.", | 449 | (Mid) of the lake.", | ||
450 | "format": "PDF", | 450 | "format": "PDF", | ||
451 | "hash": "bdb58a784524585c0227d709834fcbf6", | 451 | "hash": "bdb58a784524585c0227d709834fcbf6", | ||
452 | "header_row": "", | 452 | "header_row": "", | ||
453 | "id": "c7780c0f-2ffd-4ed9-96b1-c2f502aebf94", | 453 | "id": "c7780c0f-2ffd-4ed9-96b1-c2f502aebf94", | ||
454 | "last_modified": "2021-11-23T23:19:59.923080", | 454 | "last_modified": "2021-11-23T23:19:59.923080", | ||
455 | "load_status": "", | 455 | "load_status": "", | ||
456 | "metadata_modified": "2022-05-12T15:10:09.115268", | 456 | "metadata_modified": "2022-05-12T15:10:09.115268", | ||
457 | "mimetype": "application/pdf", | 457 | "mimetype": "application/pdf", | ||
458 | "mimetype_inner": null, | 458 | "mimetype_inner": null, | ||
459 | "name": "Lake Windermere 2013 Water Quality Monitoring Results", | 459 | "name": "Lake Windermere 2013 Water Quality Monitoring Results", | ||
460 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 460 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
461 | "position": 7, | 461 | "position": 7, | ||
462 | "resource_citation": "Lake Windermere Ambassadors. (2013). Lake | 462 | "resource_citation": "Lake Windermere Ambassadors. (2013). Lake | ||
463 | Windermere 2013 Water Quality Monitoring Results. Columbia Basin Water | 463 | Windermere 2013 Water Quality Monitoring Results. Columbia Basin Water | ||
464 | Hub [Resource].\u00a0Invermere. https://doi.org/10.48511/KBGB-DJ25", | 464 | Hub [Resource].\u00a0Invermere. https://doi.org/10.48511/KBGB-DJ25", | ||
465 | "resource_data_disclaimer": "No warranty or guarantee exists | 465 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
466 | that the information is accurate, complete, current, or suitable for | 466 | that the information is accurate, complete, current, or suitable for | ||
467 | any purpose. The individual user must confirm the accuracy of the data | 467 | any purpose. The individual user must confirm the accuracy of the data | ||
468 | and whether it will be appropriate for their purpose.", | 468 | and whether it will be appropriate for their purpose.", | ||
469 | "resource_location": "Lake Windermere", | 469 | "resource_location": "Lake Windermere", | ||
470 | "resource_type": null, | 470 | "resource_type": null, | ||
471 | "size": 1093839, | 471 | "size": 1093839, | ||
472 | "state": "active", | 472 | "state": "active", | ||
473 | "url": | 473 | "url": | ||
474 | sadors_report_lkwindermere2013waterqualitymonitoringresults_2013.pdf", | 474 | sadors_report_lkwindermere2013waterqualitymonitoringresults_2013.pdf", | ||
475 | "url_type": "upload", | 475 | "url_type": "upload", | ||
476 | "waterhub_certified": "Certified", | 476 | "waterhub_certified": "Certified", | ||
477 | "waterhub_grade": "People and Perspectives" | 477 | "waterhub_grade": "People and Perspectives" | ||
478 | }, | 478 | }, | ||
479 | { | 479 | { | ||
480 | "cache_last_updated": null, | 480 | "cache_last_updated": null, | ||
481 | "cache_url": null, | 481 | "cache_url": null, | ||
482 | "created": "2021-11-23T23:23:42.836926", | 482 | "created": "2021-11-23T23:23:42.836926", | ||
483 | "data_collection_info": "n/a", | 483 | "data_collection_info": "n/a", | ||
484 | "data_processing": "n/a", | 484 | "data_processing": "n/a", | ||
485 | "datastore_active": false, | 485 | "datastore_active": false, | ||
486 | "datastore_status": "", | 486 | "datastore_status": "", | ||
487 | "description": "In 2012 Lake Windermere Ambassadors\u2019 | 487 | "description": "In 2012 Lake Windermere Ambassadors\u2019 | ||
488 | volunteers and staff sampled lake water at three locations established | 488 | volunteers and staff sampled lake water at three locations established | ||
489 | by the Ministry of Environment and sampled over 5 years by the Lake | 489 | by the Ministry of Environment and sampled over 5 years by the Lake | ||
490 | Windermere Project. The sites cover the north and south end and center | 490 | Windermere Project. The sites cover the north and south end and center | ||
491 | of the lake.", | 491 | of the lake.", | ||
492 | "format": "PDF", | 492 | "format": "PDF", | ||
493 | "hash": "ad2d38e5d5b1caffd6a5abfe4c726287", | 493 | "hash": "ad2d38e5d5b1caffd6a5abfe4c726287", | ||
494 | "header_row": "", | 494 | "header_row": "", | ||
495 | "id": "67b8ff61-5811-4c87-bce3-86c79e22822b", | 495 | "id": "67b8ff61-5811-4c87-bce3-86c79e22822b", | ||
496 | "last_modified": "2021-11-23T23:23:42.751096", | 496 | "last_modified": "2021-11-23T23:23:42.751096", | ||
497 | "load_status": "", | 497 | "load_status": "", | ||
498 | "metadata_modified": "2022-05-12T15:11:16.926547", | 498 | "metadata_modified": "2022-05-12T15:11:16.926547", | ||
499 | "mimetype": "application/pdf", | 499 | "mimetype": "application/pdf", | ||
500 | "mimetype_inner": null, | 500 | "mimetype_inner": null, | ||
501 | "name": "Lake Windermere 2012 Water Quality Monitoring Results", | 501 | "name": "Lake Windermere 2012 Water Quality Monitoring Results", | ||
502 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 502 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
503 | "position": 8, | 503 | "position": 8, | ||
504 | "resource_citation": "Lake Windermere Ambassadors. (2012). Lake | 504 | "resource_citation": "Lake Windermere Ambassadors. (2012). Lake | ||
505 | Windermere 2012 Water Quality Monitoring Results. Columbia Basin Water | 505 | Windermere 2012 Water Quality Monitoring Results. Columbia Basin Water | ||
506 | Hub [Resource].\u00a0Invermere. https://doi.org/10.48511/KBGB-DJ25", | 506 | Hub [Resource].\u00a0Invermere. https://doi.org/10.48511/KBGB-DJ25", | ||
507 | "resource_data_disclaimer": "No warranty or guarantee exists | 507 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
508 | that the information is accurate, complete, current, or suitable for | 508 | that the information is accurate, complete, current, or suitable for | ||
509 | any purpose. The individual user must confirm the accuracy of the data | 509 | any purpose. The individual user must confirm the accuracy of the data | ||
510 | and whether it will be appropriate for their purpose.", | 510 | and whether it will be appropriate for their purpose.", | ||
511 | "resource_location": "Lake Windermere", | 511 | "resource_location": "Lake Windermere", | ||
512 | "resource_type": null, | 512 | "resource_type": null, | ||
513 | "size": 1603461, | 513 | "size": 1603461, | ||
514 | "state": "active", | 514 | "state": "active", | ||
515 | "url": | 515 | "url": | ||
516 | sadors_report_lkwindermere2012waterqualitymonitoringresults_2012.pdf", | 516 | sadors_report_lkwindermere2012waterqualitymonitoringresults_2012.pdf", | ||
517 | "url_type": "upload", | 517 | "url_type": "upload", | ||
518 | "waterhub_certified": "Certified", | 518 | "waterhub_certified": "Certified", | ||
519 | "waterhub_grade": "People and Perspectives" | 519 | "waterhub_grade": "People and Perspectives" | ||
520 | }, | 520 | }, | ||
521 | { | 521 | { | ||
522 | "cache_last_updated": null, | 522 | "cache_last_updated": null, | ||
523 | "cache_url": null, | 523 | "cache_url": null, | ||
524 | "created": "2021-11-23T23:27:43.105066", | 524 | "created": "2021-11-23T23:27:43.105066", | ||
525 | "data_collection_info": "n/a", | 525 | "data_collection_info": "n/a", | ||
526 | "data_processing": "n/a", | 526 | "data_processing": "n/a", | ||
527 | "datastore_active": false, | 527 | "datastore_active": false, | ||
528 | "datastore_status": "", | 528 | "datastore_status": "", | ||
529 | "description": "In 2011 Lake Windermere Ambassadors\u2019 | 529 | "description": "In 2011 Lake Windermere Ambassadors\u2019 | ||
530 | volunteers and staff sampled lake water at three locations established | 530 | volunteers and staff sampled lake water at three locations established | ||
531 | by the Ministry of Environment and sampled over the previous 5 years | 531 | by the Ministry of Environment and sampled over the previous 5 years | ||
532 | by the Lake Windermere Project. The sites cover the north and south | 532 | by the Lake Windermere Project. The sites cover the north and south | ||
533 | end and center of the lake.", | 533 | end and center of the lake.", | ||
534 | "format": "PDF", | 534 | "format": "PDF", | ||
535 | "hash": "2f17535074d077048b73718bf4fc99ed", | 535 | "hash": "2f17535074d077048b73718bf4fc99ed", | ||
536 | "header_row": "", | 536 | "header_row": "", | ||
537 | "id": "dcf1f2c2-9ce2-4bc3-a8c8-7b0719be9dd5", | 537 | "id": "dcf1f2c2-9ce2-4bc3-a8c8-7b0719be9dd5", | ||
538 | "last_modified": "2021-11-23T23:27:43.016982", | 538 | "last_modified": "2021-11-23T23:27:43.016982", | ||
539 | "load_status": "Invalid header row: ", | 539 | "load_status": "Invalid header row: ", | ||
540 | "metadata_modified": "2022-05-12T15:12:20.025376", | 540 | "metadata_modified": "2022-05-12T15:12:20.025376", | ||
541 | "mimetype": "application/pdf", | 541 | "mimetype": "application/pdf", | ||
542 | "mimetype_inner": null, | 542 | "mimetype_inner": null, | ||
543 | "name": "Lake Windermere 2011 Water Quality Monitoring Results", | 543 | "name": "Lake Windermere 2011 Water Quality Monitoring Results", | ||
544 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 544 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
545 | "position": 9, | 545 | "position": 9, | ||
546 | "resource_citation": "Lake Windermere Ambassadors. (2011). Lake | 546 | "resource_citation": "Lake Windermere Ambassadors. (2011). Lake | ||
547 | Windermere 2011 Water Quality Monitoring Results. Columbia Basin | 547 | Windermere 2011 Water Quality Monitoring Results. Columbia Basin | ||
548 | Water Hub [Resource].\u00a0Invermere. | 548 | Water Hub [Resource].\u00a0Invermere. | ||
549 | https://doi.org/10.48511/KBGB-DJ25", | 549 | https://doi.org/10.48511/KBGB-DJ25", | ||
550 | "resource_data_disclaimer": "No warranty or guarantee exists | 550 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
551 | that the information is accurate, complete, current, or suitable for | 551 | that the information is accurate, complete, current, or suitable for | ||
552 | any purpose. The individual user must confirm the accuracy of the data | 552 | any purpose. The individual user must confirm the accuracy of the data | ||
553 | and whether it will be appropriate for their purpose.", | 553 | and whether it will be appropriate for their purpose.", | ||
554 | "resource_location": "Lake Windermere", | 554 | "resource_location": "Lake Windermere", | ||
555 | "resource_type": null, | 555 | "resource_type": null, | ||
556 | "size": 1593707, | 556 | "size": 1593707, | ||
557 | "state": "active", | 557 | "state": "active", | ||
558 | "url": | 558 | "url": | ||
559 | sadors_report_lkwindermere2011waterqualitymonitoringresults_2011.pdf", | 559 | sadors_report_lkwindermere2011waterqualitymonitoringresults_2011.pdf", | ||
560 | "url_type": "upload", | 560 | "url_type": "upload", | ||
561 | "waterhub_certified": "Certified", | 561 | "waterhub_certified": "Certified", | ||
562 | "waterhub_grade": "People and Perspectives" | 562 | "waterhub_grade": "People and Perspectives" | ||
563 | }, | 563 | }, | ||
564 | { | 564 | { | ||
565 | "cache_last_updated": null, | 565 | "cache_last_updated": null, | ||
566 | "cache_url": null, | 566 | "cache_url": null, | ||
567 | "created": "2021-11-23T23:35:04.672563", | 567 | "created": "2021-11-23T23:35:04.672563", | ||
568 | "data_collection_info": "n/a", | 568 | "data_collection_info": "n/a", | ||
569 | "data_processing": "n/a", | 569 | "data_processing": "n/a", | ||
570 | "datastore_active": false, | 570 | "datastore_active": false, | ||
571 | "datastore_status": "", | 571 | "datastore_status": "", | ||
572 | "description": "The objectives of this water quality monitoring | 572 | "description": "The objectives of this water quality monitoring | ||
573 | report are as follows:\r\n1. Present CABIN, sediment and water | 573 | report are as follows:\r\n1. Present CABIN, sediment and water | ||
574 | quality, and continual stream temperature data collected to date in a | 574 | quality, and continual stream temperature data collected to date in a | ||
575 | format that can be used for analysis and ongoing assessment.\r\n2. | 575 | format that can be used for analysis and ongoing assessment.\r\n2. | ||
576 | Analyse biological monitoring data (CABIN). Complete the analysis | 576 | Analyse biological monitoring data (CABIN). Complete the analysis | ||
577 | using the analytical tools in the CABIN database by classifying | 577 | using the analytical tools in the CABIN database by classifying | ||
578 | benthic invertebrate community stress at sampling sites according the | 578 | benthic invertebrate community stress at sampling sites according the | ||
579 | Reference Condition Approach and calculating invertebrate community | 579 | Reference Condition Approach and calculating invertebrate community | ||
580 | metrics.\r\n3. Analyse water and sediment quality data to identify if | 580 | metrics.\r\n3. Analyse water and sediment quality data to identify if | ||
581 | there were any parameters of potential concern in the study area. | 581 | there were any parameters of potential concern in the study area. | ||
582 | Complete this review by comparing monitoring results to applicable | 582 | Complete this review by comparing monitoring results to applicable | ||
583 | federal and provincial guidelines for the protection of aquatic life | 583 | federal and provincial guidelines for the protection of aquatic life | ||
584 | and drinking water, where available.\r\n4. Analyse stream temperature | 584 | and drinking water, where available.\r\n4. Analyse stream temperature | ||
585 | data obtained from the continual data logger(s).\r\n5. Relate | 585 | data obtained from the continual data logger(s).\r\n5. Relate | ||
586 | biological results to water/sediment quality and stream temperature | 586 | biological results to water/sediment quality and stream temperature | ||
587 | findings.\r\n6. Provide recommendations for future stream health data | 587 | findings.\r\n6. Provide recommendations for future stream health data | ||
588 | collection including applicable data to be collected, locations to be | 588 | collection including applicable data to be collected, locations to be | ||
589 | sampled, and procedures.", | 589 | sampled, and procedures.", | ||
590 | "format": "PDF", | 590 | "format": "PDF", | ||
591 | "hash": "04badeed083a9d66712fcc286d31092d", | 591 | "hash": "04badeed083a9d66712fcc286d31092d", | ||
592 | "header_row": "", | 592 | "header_row": "", | ||
593 | "id": "121fbbc0-d5cc-4ac2-ad41-e9f00e2eba47", | 593 | "id": "121fbbc0-d5cc-4ac2-ad41-e9f00e2eba47", | ||
594 | "last_modified": "2021-11-23T23:35:04.581894", | 594 | "last_modified": "2021-11-23T23:35:04.581894", | ||
595 | "load_status": "", | 595 | "load_status": "", | ||
596 | "metadata_modified": "2022-05-12T15:13:30.023730", | 596 | "metadata_modified": "2022-05-12T15:13:30.023730", | ||
597 | "mimetype": "application/pdf", | 597 | "mimetype": "application/pdf", | ||
598 | "mimetype_inner": null, | 598 | "mimetype_inner": null, | ||
599 | "name": "Water Quality Monitoring Report 2009 \u2013 2012", | 599 | "name": "Water Quality Monitoring Report 2009 \u2013 2012", | ||
600 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 600 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
601 | "position": 10, | 601 | "position": 10, | ||
602 | "resource_citation": "McPherson, S., K. Kuchapski, and R. | 602 | "resource_citation": "McPherson, S., K. Kuchapski, and R. | ||
603 | MacDonald. 2014. Windermere Creek 2009-2012, water quality monitoring | 603 | MacDonald. 2014. Windermere Creek 2009-2012, water quality monitoring | ||
604 | report. A Columbia Basin Water Quality Monitoring Project. Prepared by | 604 | report. A Columbia Basin Water Quality Monitoring Project. Prepared by | ||
605 | Lotic Environmental Ltd. for Wildsight. [Resource} | 605 | Lotic Environmental Ltd. for Wildsight. [Resource} | ||
606 | https://doi.org/10.48511/KBGB-DJ25", | 606 | https://doi.org/10.48511/KBGB-DJ25", | ||
607 | "resource_data_disclaimer": "No warranty or guarantee exists | 607 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
608 | that the information is accurate, complete, current, or suitable for | 608 | that the information is accurate, complete, current, or suitable for | ||
609 | any purpose. The individual user must confirm the accuracy of the data | 609 | any purpose. The individual user must confirm the accuracy of the data | ||
610 | and whether it will be appropriate for their purpose.", | 610 | and whether it will be appropriate for their purpose.", | ||
611 | "resource_location": "Windermere Creek", | 611 | "resource_location": "Windermere Creek", | ||
612 | "resource_type": null, | 612 | "resource_type": null, | ||
613 | "size": 1166753, | 613 | "size": 1166753, | ||
614 | "state": "active", | 614 | "state": "active", | ||
615 | "url": | 615 | "url": | ||
616 | ntal_report_windermerecreekwaterqualitymonitoringreport2009_2012.pdf", | 616 | ntal_report_windermerecreekwaterqualitymonitoringreport2009_2012.pdf", | ||
617 | "url_type": "upload", | 617 | "url_type": "upload", | ||
618 | "waterhub_certified": "Certified", | 618 | "waterhub_certified": "Certified", | ||
619 | "waterhub_grade": "People and Perspectives" | 619 | "waterhub_grade": "People and Perspectives" | ||
620 | }, | 620 | }, | ||
621 | { | 621 | { | ||
622 | "cache_last_updated": null, | 622 | "cache_last_updated": null, | ||
623 | "cache_url": null, | 623 | "cache_url": null, | ||
624 | "created": "2021-11-23T21:47:42.044031", | 624 | "created": "2021-11-23T21:47:42.044031", | ||
625 | "data_collection_info": "n/a", | 625 | "data_collection_info": "n/a", | ||
626 | "data_processing": "n/a", | 626 | "data_processing": "n/a", | ||
627 | "datastore_active": false, | 627 | "datastore_active": false, | ||
628 | "datastore_status": "", | 628 | "datastore_status": "", | ||
629 | "description": "Data and information included in this report is | 629 | "description": "Data and information included in this report is | ||
630 | a first and preliminary examination of results from Windermere Creek | 630 | a first and preliminary examination of results from Windermere Creek | ||
631 | (BC), which consists of a list of the macroinvertebrate taxa detected | 631 | (BC), which consists of a list of the macroinvertebrate taxa detected | ||
632 | within the samples submitted. This report aims to highlight the | 632 | within the samples submitted. This report aims to highlight the | ||
633 | different macroinvertebrate EPT taxa and provide basic richness | 633 | different macroinvertebrate EPT taxa and provide basic richness | ||
634 | metrics as a useful contribution for community groups to assess river | 634 | metrics as a useful contribution for community groups to assess river | ||
635 | health.", | 635 | health.", | ||
636 | "format": "PDF", | 636 | "format": "PDF", | ||
637 | "hash": "5a1afd2f11385df53ebcddc0131d43f9", | 637 | "hash": "5a1afd2f11385df53ebcddc0131d43f9", | ||
638 | "header_row": "", | 638 | "header_row": "", | ||
639 | "id": "04d7f4c8-f731-4980-aa59-8c8a1a0db5bf", | 639 | "id": "04d7f4c8-f731-4980-aa59-8c8a1a0db5bf", | ||
640 | "last_modified": "2021-11-23T21:47:41.981461", | 640 | "last_modified": "2021-11-23T21:47:41.981461", | ||
641 | "load_status": "Invalid header row: ", | 641 | "load_status": "Invalid header row: ", | ||
642 | "metadata_modified": "2022-05-12T14:51:20.536884", | 642 | "metadata_modified": "2022-05-12T14:51:20.536884", | ||
643 | "mimetype": "application/pdf", | 643 | "mimetype": "application/pdf", | ||
644 | "mimetype_inner": null, | 644 | "mimetype_inner": null, | ||
645 | "name": "Preliminary DNA Data Windermere Creek, BC Columbia | 645 | "name": "Preliminary DNA Data Windermere Creek, BC Columbia | ||
646 | Basin Water Quality Monitoring Project - Windermere Creek", | 646 | Basin Water Quality Monitoring Project - Windermere Creek", | ||
647 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 647 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
648 | "position": 11, | 648 | "position": 11, | ||
649 | "resource_citation": "Lake Windermere Ambassadors. (2019). | 649 | "resource_citation": "Lake Windermere Ambassadors. (2019). | ||
650 | Preliminary DNA Data Windermere Creek, BC Columbia Basin Water Quality | 650 | Preliminary DNA Data Windermere Creek, BC Columbia Basin Water Quality | ||
651 | Monitoring Project - Windermere Creek. Prepared for WWF Canada, | 651 | Monitoring Project - Windermere Creek. Prepared for WWF Canada, | ||
652 | Environment and Climate Change Canada, Living Lakes Canada. Columbia | 652 | Environment and Climate Change Canada, Living Lakes Canada. Columbia | ||
653 | Basin Water Hub [Resource]. Invermere. | 653 | Basin Water Hub [Resource]. Invermere. | ||
654 | https://doi.org/10.48511/KBGB-DJ25", | 654 | https://doi.org/10.48511/KBGB-DJ25", | ||
655 | "resource_data_disclaimer": "No warranty or guarantee exists | 655 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
656 | that the information is accurate, complete, current, or suitable for | 656 | that the information is accurate, complete, current, or suitable for | ||
657 | any purpose. The individual user must confirm the accuracy of the data | 657 | any purpose. The individual user must confirm the accuracy of the data | ||
658 | and whether it will be appropriate for their purpose.", | 658 | and whether it will be appropriate for their purpose.", | ||
659 | "resource_location": "Windermere Creek", | 659 | "resource_location": "Windermere Creek", | ||
660 | "resource_type": null, | 660 | "resource_type": null, | ||
661 | "size": 408000, | 661 | "size": 408000, | ||
662 | "state": "active", | 662 | "state": "active", | ||
663 | "url": | 663 | "url": | ||
664 | ermere-ambassadors_report_preliminarydnadatawindermerecreek_2019.pdf", | 664 | ermere-ambassadors_report_preliminarydnadatawindermerecreek_2019.pdf", | ||
665 | "url_type": "upload", | 665 | "url_type": "upload", | ||
666 | "waterhub_certified": "Certified", | 666 | "waterhub_certified": "Certified", | ||
667 | "waterhub_grade": "People and Perspectives" | 667 | "waterhub_grade": "People and Perspectives" | ||
668 | }, | 668 | }, | ||
669 | { | 669 | { | ||
670 | "cache_last_updated": null, | 670 | "cache_last_updated": null, | ||
671 | "cache_url": null, | 671 | "cache_url": null, | ||
672 | "created": "2021-11-23T22:10:12.978806", | 672 | "created": "2021-11-23T22:10:12.978806", | ||
673 | "data_collection_info": "n/a", | 673 | "data_collection_info": "n/a", | ||
674 | "data_processing": "n/a", | 674 | "data_processing": "n/a", | ||
675 | "datastore_active": false, | 675 | "datastore_active": false, | ||
676 | "datastore_status": "", | 676 | "datastore_status": "", | ||
677 | "description": "No aquatic invasive plant species were detected | 677 | "description": "No aquatic invasive plant species were detected | ||
678 | during shoreline surveys. There was a notable lack of aquatic plants | 678 | during shoreline surveys. There was a notable lack of aquatic plants | ||
679 | detected at the following survey stations: Baltac Beach, End of Ruault | 679 | detected at the following survey stations: Baltac Beach, End of Ruault | ||
680 | Rd, and Unofficial boat launch near Bayshore Condos.\r\n\r\nNo aquatic | 680 | Rd, and Unofficial boat launch near Bayshore Condos.\r\n\r\nNo aquatic | ||
681 | invasive plant species were detected during offshore surveys. As with | 681 | invasive plant species were detected during offshore surveys. As with | ||
682 | previous years of survey effort, dense areas or beds of indigenous | 682 | previous years of survey effort, dense areas or beds of indigenous | ||
683 | aquatic plants were observed in specific locations such as Ruault Road | 683 | aquatic plants were observed in specific locations such as Ruault Road | ||
684 | and Althalmer/Pete\u2019s Marina (Figure 1). There were some survey | 684 | and Althalmer/Pete\u2019s Marina (Figure 1). There were some survey | ||
685 | stations that were essentially devoid of aquatic plant communities, | 685 | stations that were essentially devoid of aquatic plant communities, | ||
686 | such as Baltac Beach, Unofficial boat launch near Bayshore Condos, and | 686 | such as Baltac Beach, Unofficial boat launch near Bayshore Condos, and | ||
687 | Tretheway Docks.", | 687 | Tretheway Docks.", | ||
688 | "format": "PDF", | 688 | "format": "PDF", | ||
689 | "hash": "6a3f5d12b394b13926e9fbb7552b66fa", | 689 | "hash": "6a3f5d12b394b13926e9fbb7552b66fa", | ||
690 | "header_row": "", | 690 | "header_row": "", | ||
691 | "id": "141a882d-dcb3-4ff2-bd42-3ee3fb580f0e", | 691 | "id": "141a882d-dcb3-4ff2-bd42-3ee3fb580f0e", | ||
692 | "last_modified": "2021-11-23T22:10:12.915634", | 692 | "last_modified": "2021-11-23T22:10:12.915634", | ||
693 | "load_status": "", | 693 | "load_status": "", | ||
694 | "metadata_modified": "2022-05-12T15:14:45.547914", | 694 | "metadata_modified": "2022-05-12T15:14:45.547914", | ||
695 | "mimetype": "application/pdf", | 695 | "mimetype": "application/pdf", | ||
696 | "mimetype_inner": null, | 696 | "mimetype_inner": null, | ||
697 | "name": "Aquatic Invasive Plant Species Inventory 2019", | 697 | "name": "Aquatic Invasive Plant Species Inventory 2019", | ||
698 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 698 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
699 | "position": 12, | 699 | "position": 12, | ||
700 | "resource_citation": "Darvill. (2019). Lake Windermere Aquatic | 700 | "resource_citation": "Darvill. (2019). Lake Windermere Aquatic | ||
701 | Invasive Plant Species Inventory 2019. Prepared for Lake Windermere | 701 | Invasive Plant Species Inventory 2019. Prepared for Lake Windermere | ||
702 | Ambassadors. Columbia Basin Water Hub [Resource].\u00a0Parson. | 702 | Ambassadors. Columbia Basin Water Hub [Resource].\u00a0Parson. | ||
703 | https://doi.org/10.48511/KBGB-DJ25", | 703 | https://doi.org/10.48511/KBGB-DJ25", | ||
704 | "resource_data_disclaimer": "No warranty or guarantee exists | 704 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
705 | that the information is accurate, complete, current, or suitable for | 705 | that the information is accurate, complete, current, or suitable for | ||
706 | any purpose. The individual user must confirm the accuracy of the data | 706 | any purpose. The individual user must confirm the accuracy of the data | ||
707 | and whether it will be appropriate for their purpose.", | 707 | and whether it will be appropriate for their purpose.", | ||
708 | "resource_location": "Lake Windermere", | 708 | "resource_location": "Lake Windermere", | ||
709 | "resource_type": null, | 709 | "resource_type": null, | ||
710 | "size": 1454992, | 710 | "size": 1454992, | ||
711 | "state": "active", | 711 | "state": "active", | ||
712 | "url": | 712 | "url": | ||
713 | _report_lakewindermereaquaticinvasiveplantspecies-inventory_2019.pdf", | 713 | _report_lakewindermereaquaticinvasiveplantspecies-inventory_2019.pdf", | ||
714 | "url_type": "upload", | 714 | "url_type": "upload", | ||
715 | "waterhub_certified": "Certified", | 715 | "waterhub_certified": "Certified", | ||
716 | "waterhub_grade": "People and Perspectives" | 716 | "waterhub_grade": "People and Perspectives" | ||
717 | }, | 717 | }, | ||
718 | { | 718 | { | ||
719 | "cache_last_updated": null, | 719 | "cache_last_updated": null, | ||
720 | "cache_url": null, | 720 | "cache_url": null, | ||
721 | "created": "2021-11-23T22:31:35.205581", | 721 | "created": "2021-11-23T22:31:35.205581", | ||
722 | "data_collection_info": "n/a", | 722 | "data_collection_info": "n/a", | ||
723 | "data_processing": "n/a", | 723 | "data_processing": "n/a", | ||
724 | "datastore_active": false, | 724 | "datastore_active": false, | ||
725 | "datastore_status": "", | 725 | "datastore_status": "", | ||
726 | "description": "No aquatic invasive plant species were detected | 726 | "description": "No aquatic invasive plant species were detected | ||
727 | during shoreline surveys. Aquatic invasive plant species detection is | 727 | during shoreline surveys. Aquatic invasive plant species detection is | ||
728 | the primary focus on this study. However, all native plant species | 728 | the primary focus on this study. However, all native plant species | ||
729 | that were collected through rake pulls are listed in Appendix 1. | 729 | that were collected through rake pulls are listed in Appendix 1. | ||
730 | \r\n\r\nAll offshore sampling resulted in no aquatic invasive plant | 730 | \r\n\r\nAll offshore sampling resulted in no aquatic invasive plant | ||
731 | species being detected. As with previous years of survey effort, dense | 731 | species being detected. As with previous years of survey effort, dense | ||
732 | areas of native aquatic plants were observed in locations such as | 732 | areas of native aquatic plants were observed in locations such as | ||
733 | Ruault Road and Althalmer/Pete\u2019s Marina. While aquatic invasive | 733 | Ruault Road and Althalmer/Pete\u2019s Marina. While aquatic invasive | ||
734 | plant detection was the primary focus of this study, all native | 734 | plant detection was the primary focus of this study, all native | ||
735 | aquatic plants were identified to the species level where possible, | 735 | aquatic plants were identified to the species level where possible, | ||
736 | and are listed in Appendix 2.", | 736 | and are listed in Appendix 2.", | ||
737 | "format": "PDF", | 737 | "format": "PDF", | ||
738 | "hash": "97d2fed2747971fb1bd9e1bc07637600", | 738 | "hash": "97d2fed2747971fb1bd9e1bc07637600", | ||
739 | "header_row": "", | 739 | "header_row": "", | ||
740 | "id": "bff727d2-e463-4a01-9c21-768180cbb0f5", | 740 | "id": "bff727d2-e463-4a01-9c21-768180cbb0f5", | ||
741 | "last_modified": "2021-11-23T22:31:35.136576", | 741 | "last_modified": "2021-11-23T22:31:35.136576", | ||
742 | "load_status": "", | 742 | "load_status": "", | ||
743 | "metadata_modified": "2022-05-12T15:16:06.658315", | 743 | "metadata_modified": "2022-05-12T15:16:06.658315", | ||
744 | "mimetype": "application/pdf", | 744 | "mimetype": "application/pdf", | ||
745 | "mimetype_inner": null, | 745 | "mimetype_inner": null, | ||
746 | "name": "Aquatic Invasive Plant Species Inventory 2018", | 746 | "name": "Aquatic Invasive Plant Species Inventory 2018", | ||
747 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 747 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
748 | "position": 13, | 748 | "position": 13, | ||
749 | "resource_citation": "Darvill. (2018). Lake Windermere Aquatic | 749 | "resource_citation": "Darvill. (2018). Lake Windermere Aquatic | ||
750 | Invasive Plant Species Inventory 2018. Prepared for Lake Windermere | 750 | Invasive Plant Species Inventory 2018. Prepared for Lake Windermere | ||
751 | Ambassadors. Columbia Basin Water Hub [Resource].\u00a0 Parson. | 751 | Ambassadors. Columbia Basin Water Hub [Resource].\u00a0 Parson. | ||
752 | https://doi.org/10.48511/KBGB-DJ25", | 752 | https://doi.org/10.48511/KBGB-DJ25", | ||
753 | "resource_data_disclaimer": "No warranty or guarantee exists | 753 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
754 | that the information is accurate, complete, current, or suitable for | 754 | that the information is accurate, complete, current, or suitable for | ||
755 | any purpose. The individual user must confirm the accuracy of the data | 755 | any purpose. The individual user must confirm the accuracy of the data | ||
756 | and whether it will be appropriate for their purpose.", | 756 | and whether it will be appropriate for their purpose.", | ||
757 | "resource_location": "Lake Windermere", | 757 | "resource_location": "Lake Windermere", | ||
758 | "resource_type": null, | 758 | "resource_type": null, | ||
759 | "size": 1354021, | 759 | "size": 1354021, | ||
760 | "state": "active", | 760 | "state": "active", | ||
761 | "url": | 761 | "url": | ||
762 | darvill_report_lakewindermereaquaticinvasiveplantsinventory_2018.pdf", | 762 | darvill_report_lakewindermereaquaticinvasiveplantsinventory_2018.pdf", | ||
763 | "url_type": "upload", | 763 | "url_type": "upload", | ||
764 | "waterhub_certified": "Certified", | 764 | "waterhub_certified": "Certified", | ||
765 | "waterhub_grade": "People and Perspectives" | 765 | "waterhub_grade": "People and Perspectives" | ||
766 | }, | 766 | }, | ||
767 | { | 767 | { | ||
768 | "cache_last_updated": null, | 768 | "cache_last_updated": null, | ||
769 | "cache_url": null, | 769 | "cache_url": null, | ||
770 | "created": "2021-11-23T22:44:38.629271", | 770 | "created": "2021-11-23T22:44:38.629271", | ||
771 | "data_collection_info": "n/a", | 771 | "data_collection_info": "n/a", | ||
772 | "data_processing": "n/a", | 772 | "data_processing": "n/a", | ||
773 | "datastore_active": false, | 773 | "datastore_active": false, | ||
774 | "datastore_status": "", | 774 | "datastore_status": "", | ||
775 | "description": "No aquatic invasive plant species were detected | 775 | "description": "No aquatic invasive plant species were detected | ||
776 | during the shoreline surveys. Aquatic invasive plant species detection | 776 | during the shoreline surveys. Aquatic invasive plant species detection | ||
777 | is the primary focus on this study; however, all native plant species | 777 | is the primary focus on this study; however, all native plant species | ||
778 | that were collected through rake pulls are listed in Appendix 1. | 778 | that were collected through rake pulls are listed in Appendix 1. | ||
779 | \r\n\r\nAll offshore sampling resulted in the detection of no aquatic | 779 | \r\n\r\nAll offshore sampling resulted in the detection of no aquatic | ||
780 | invasive plant species. Multiple beds of dense native aquatic plants | 780 | invasive plant species. Multiple beds of dense native aquatic plants | ||
781 | were located in locations such as Ruault Road and | 781 | were located in locations such as Ruault Road and | ||
782 | Althalmer/Pete\u2019s Marina. While aquatic invasive plant detection | 782 | Althalmer/Pete\u2019s Marina. While aquatic invasive plant detection | ||
783 | was the primary focus of this study, all native aquatic plants were | 783 | was the primary focus of this study, all native aquatic plants were | ||
784 | identified to the species level where possible, and are listed in | 784 | identified to the species level where possible, and are listed in | ||
785 | Appendix 2.\r\n\r\nAll veliger samples submitted by the EKISP to the | 785 | Appendix 2.\r\n\r\nAll veliger samples submitted by the EKISP to the | ||
786 | appropriate laboratory were reported back to the EKISC as negative. | 786 | appropriate laboratory were reported back to the EKISC as negative. | ||
787 | This indicates that no invasive mussel (Zebra Mussel (Dreissena | 787 | This indicates that no invasive mussel (Zebra Mussel (Dreissena | ||
788 | polymorph)/Quagga Mussel (Dreissena bugensis) veligers were identified | 788 | polymorph)/Quagga Mussel (Dreissena bugensis) veligers were identified | ||
789 | by the laboratory that analyzed the samples.", | 789 | by the laboratory that analyzed the samples.", | ||
790 | "format": "PDF", | 790 | "format": "PDF", | ||
791 | "hash": "2cc5a8ceb551df27d99f5f9718a11f46", | 791 | "hash": "2cc5a8ceb551df27d99f5f9718a11f46", | ||
792 | "header_row": "", | 792 | "header_row": "", | ||
793 | "id": "8cebdc8d-85ed-4c17-941e-3c50e4d84cd4", | 793 | "id": "8cebdc8d-85ed-4c17-941e-3c50e4d84cd4", | ||
794 | "last_modified": "2021-11-23T22:44:38.559073", | 794 | "last_modified": "2021-11-23T22:44:38.559073", | ||
795 | "load_status": "", | 795 | "load_status": "", | ||
796 | "metadata_modified": "2022-05-12T15:17:28.890212", | 796 | "metadata_modified": "2022-05-12T15:17:28.890212", | ||
797 | "mimetype": "application/pdf", | 797 | "mimetype": "application/pdf", | ||
798 | "mimetype_inner": null, | 798 | "mimetype_inner": null, | ||
799 | "name": "Aquatic Invasive Species Inventory 2017", | 799 | "name": "Aquatic Invasive Species Inventory 2017", | ||
800 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 800 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
801 | "position": 14, | 801 | "position": 14, | ||
802 | "resource_citation": "Darvill. (2017). Lake Windermere Aquatic | 802 | "resource_citation": "Darvill. (2017). Lake Windermere Aquatic | ||
803 | Invasive Species Inventory 2017. Prepared for Lake Windermere | 803 | Invasive Species Inventory 2017. Prepared for Lake Windermere | ||
804 | Ambassadors. Columbia Basin Water Hub [Resource].\u00a0Parson. | 804 | Ambassadors. Columbia Basin Water Hub [Resource].\u00a0Parson. | ||
805 | https://doi.org/10.48511/KBGB-DJ25", | 805 | https://doi.org/10.48511/KBGB-DJ25", | ||
806 | "resource_data_disclaimer": "No warranty or guarantee exists | 806 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
807 | that the information is accurate, complete, current, or suitable for | 807 | that the information is accurate, complete, current, or suitable for | ||
808 | any purpose. The individual user must confirm the accuracy of the data | 808 | any purpose. The individual user must confirm the accuracy of the data | ||
809 | and whether it will be appropriate for their purpose.", | 809 | and whether it will be appropriate for their purpose.", | ||
810 | "resource_location": "Lake Windermere", | 810 | "resource_location": "Lake Windermere", | ||
811 | "resource_type": null, | 811 | "resource_type": null, | ||
812 | "size": 1501477, | 812 | "size": 1501477, | ||
813 | "state": "active", | 813 | "state": "active", | ||
814 | "url": | 814 | "url": | ||
815 | darvill_report_lakewindermereaquaticinvasiveplantsinventory_2017.pdf", | 815 | darvill_report_lakewindermereaquaticinvasiveplantsinventory_2017.pdf", | ||
816 | "url_type": "upload", | 816 | "url_type": "upload", | ||
817 | "waterhub_certified": "Certified", | 817 | "waterhub_certified": "Certified", | ||
818 | "waterhub_grade": "People and Perspectives" | 818 | "waterhub_grade": "People and Perspectives" | ||
819 | }, | 819 | }, | ||
820 | { | 820 | { | ||
821 | "cache_last_updated": null, | 821 | "cache_last_updated": null, | ||
822 | "cache_url": null, | 822 | "cache_url": null, | ||
823 | "created": "2021-11-23T22:57:01.513020", | 823 | "created": "2021-11-23T22:57:01.513020", | ||
824 | "data_collection_info": "n/a", | 824 | "data_collection_info": "n/a", | ||
825 | "data_processing": "n/a", | 825 | "data_processing": "n/a", | ||
826 | "datastore_active": false, | 826 | "datastore_active": false, | ||
827 | "datastore_status": "", | 827 | "datastore_status": "", | ||
828 | "description": "The purpose of conducting AIS monitoring on Lake | 828 | "description": "The purpose of conducting AIS monitoring on Lake | ||
829 | Windermere in 2016 is to sample both offshore and onshore locations | 829 | Windermere in 2016 is to sample both offshore and onshore locations | ||
830 | for AIS such as Eurasian Watermilfoil (Myriophyllum spicatum), | 830 | for AIS such as Eurasian Watermilfoil (Myriophyllum spicatum), | ||
831 | Curyleaf Pondweed (Potamogeton crispu), Zebra Mussel (Dreissena | 831 | Curyleaf Pondweed (Potamogeton crispu), Zebra Mussel (Dreissena | ||
832 | polymorph) and Quagga Mussel (Dreissena bugensis). Continuing to | 832 | polymorph) and Quagga Mussel (Dreissena bugensis). Continuing to | ||
833 | sample for AIS on an annual basis on Lake Windermere will facilitate a | 833 | sample for AIS on an annual basis on Lake Windermere will facilitate a | ||
834 | rapid response for any detected species within this high risk lake | 834 | rapid response for any detected species within this high risk lake | ||
835 | ecosystem.", | 835 | ecosystem.", | ||
836 | "format": "PDF", | 836 | "format": "PDF", | ||
837 | "hash": "0e9235356278419204fd47722949065b", | 837 | "hash": "0e9235356278419204fd47722949065b", | ||
838 | "header_row": "", | 838 | "header_row": "", | ||
839 | "id": "cf49cf49-5e4a-494a-bb7f-5fd57fc88c02", | 839 | "id": "cf49cf49-5e4a-494a-bb7f-5fd57fc88c02", | ||
840 | "last_modified": "2021-11-23T22:57:01.438585", | 840 | "last_modified": "2021-11-23T22:57:01.438585", | ||
841 | "load_status": "", | 841 | "load_status": "", | ||
842 | "metadata_modified": "2022-05-12T15:19:10.485853", | 842 | "metadata_modified": "2022-05-12T15:19:10.485853", | ||
843 | "mimetype": "application/pdf", | 843 | "mimetype": "application/pdf", | ||
844 | "mimetype_inner": null, | 844 | "mimetype_inner": null, | ||
845 | "name": "Aquatic Invasive Species Sampling 2016", | 845 | "name": "Aquatic Invasive Species Sampling 2016", | ||
846 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 846 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
847 | "position": 15, | 847 | "position": 15, | ||
848 | "resource_citation": "Darvill. (2016). Lake Windermere Aquatic | 848 | "resource_citation": "Darvill. (2016). Lake Windermere Aquatic | ||
849 | Invasive Species Sampling 2016. Prepared for Lake Windermere | 849 | Invasive Species Sampling 2016. Prepared for Lake Windermere | ||
850 | Ambassadors. Columbia Basin Water Hub [Resource].\u00a0Parson. | 850 | Ambassadors. Columbia Basin Water Hub [Resource].\u00a0Parson. | ||
851 | https://doi.org/10.48511/KBGB-DJ25", | 851 | https://doi.org/10.48511/KBGB-DJ25", | ||
852 | "resource_data_disclaimer": "No warranty or guarantee exists | 852 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
853 | that the information is accurate, complete, current, or suitable for | 853 | that the information is accurate, complete, current, or suitable for | ||
854 | any purpose. The individual user must confirm the accuracy of the data | 854 | any purpose. The individual user must confirm the accuracy of the data | ||
855 | and whether it will be appropriate for their purpose.", | 855 | and whether it will be appropriate for their purpose.", | ||
856 | "resource_location": "Lake Windermere", | 856 | "resource_location": "Lake Windermere", | ||
857 | "resource_type": null, | 857 | "resource_type": null, | ||
858 | "size": 1528687, | 858 | "size": 1528687, | ||
859 | "state": "active", | 859 | "state": "active", | ||
860 | "url": | 860 | "url": | ||
861 | darvill_report_lakewindermereaquaticinvasiveplantsinventory_2016.pdf", | 861 | darvill_report_lakewindermereaquaticinvasiveplantsinventory_2016.pdf", | ||
862 | "url_type": "upload", | 862 | "url_type": "upload", | ||
863 | "waterhub_certified": "Certified", | 863 | "waterhub_certified": "Certified", | ||
864 | "waterhub_grade": "People and Perspectives" | 864 | "waterhub_grade": "People and Perspectives" | ||
865 | }, | 865 | }, | ||
866 | { | 866 | { | ||
867 | "cache_last_updated": null, | 867 | "cache_last_updated": null, | ||
868 | "cache_url": null, | 868 | "cache_url": null, | ||
869 | "created": "2021-11-23T23:10:09.741094", | 869 | "created": "2021-11-23T23:10:09.741094", | ||
870 | "data_collection_info": "n/a", | 870 | "data_collection_info": "n/a", | ||
871 | "data_processing": "n/a", | 871 | "data_processing": "n/a", | ||
872 | "datastore_active": false, | 872 | "datastore_active": false, | ||
873 | "datastore_status": "", | 873 | "datastore_status": "", | ||
874 | "description": "This year (2015) marked the sixth successive | 874 | "description": "This year (2015) marked the sixth successive | ||
875 | year (with the exception of 2013) where aquatic plants were sampled | 875 | year (with the exception of 2013) where aquatic plants were sampled | ||
876 | along multiple locations along the Lake Windermere shoreline. This | 876 | along multiple locations along the Lake Windermere shoreline. This | ||
877 | year also saw the first year of AIS sampling from a boat at offshore | 877 | year also saw the first year of AIS sampling from a boat at offshore | ||
878 | locations, including veliger sampling for invasive mussels (quagga and | 878 | locations, including veliger sampling for invasive mussels (quagga and | ||
879 | zebra).", | 879 | zebra).", | ||
880 | "format": "PDF", | 880 | "format": "PDF", | ||
881 | "hash": "c905077c6c7766a76ded7f930dc0f8ee", | 881 | "hash": "c905077c6c7766a76ded7f930dc0f8ee", | ||
882 | "header_row": "", | 882 | "header_row": "", | ||
883 | "id": "c52fe1c4-6791-4ac0-b1b8-5aa8123829f2", | 883 | "id": "c52fe1c4-6791-4ac0-b1b8-5aa8123829f2", | ||
884 | "last_modified": "2021-11-23T23:10:09.658955", | 884 | "last_modified": "2021-11-23T23:10:09.658955", | ||
885 | "load_status": "", | 885 | "load_status": "", | ||
886 | "metadata_modified": "2022-05-12T15:20:20.468533", | 886 | "metadata_modified": "2022-05-12T15:20:20.468533", | ||
887 | "mimetype": "application/pdf", | 887 | "mimetype": "application/pdf", | ||
888 | "mimetype_inner": null, | 888 | "mimetype_inner": null, | ||
889 | "name": "Aquatic Invasive Plant Sampling 2015", | 889 | "name": "Aquatic Invasive Plant Sampling 2015", | ||
890 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 890 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
891 | "position": 16, | 891 | "position": 16, | ||
892 | "resource_citation": "Darvill. (2015). Lake Windermere Aquatic | 892 | "resource_citation": "Darvill. (2015). Lake Windermere Aquatic | ||
893 | Invasive Plant Sampling 2015. Prepared for Lake Windermere | 893 | Invasive Plant Sampling 2015. Prepared for Lake Windermere | ||
894 | Ambassadors. Columbia Basin Water Hub [Resource].\u00a0Parson. | 894 | Ambassadors. Columbia Basin Water Hub [Resource].\u00a0Parson. | ||
895 | https://doi.org/10.48511/KBGB-DJ25", | 895 | https://doi.org/10.48511/KBGB-DJ25", | ||
896 | "resource_data_disclaimer": "No warranty or guarantee exists | 896 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
897 | that the information is accurate, complete, current, or suitable for | 897 | that the information is accurate, complete, current, or suitable for | ||
898 | any purpose. The individual user must confirm the accuracy of the data | 898 | any purpose. The individual user must confirm the accuracy of the data | ||
899 | and whether it will be appropriate for their purpose.", | 899 | and whether it will be appropriate for their purpose.", | ||
900 | "resource_location": "Lake Windermere", | 900 | "resource_location": "Lake Windermere", | ||
901 | "resource_type": null, | 901 | "resource_type": null, | ||
902 | "size": 894650, | 902 | "size": 894650, | ||
903 | "state": "active", | 903 | "state": "active", | ||
904 | "url": | 904 | "url": | ||
905 | darvill_report_lakewindermereaquaticinvasiveplantsinventory_2015.pdf", | 905 | darvill_report_lakewindermereaquaticinvasiveplantsinventory_2015.pdf", | ||
906 | "url_type": "upload", | 906 | "url_type": "upload", | ||
907 | "waterhub_certified": "Certified", | 907 | "waterhub_certified": "Certified", | ||
908 | "waterhub_grade": "People and Perspectives" | 908 | "waterhub_grade": "People and Perspectives" | ||
909 | }, | 909 | }, | ||
910 | { | 910 | { | ||
911 | "cache_last_updated": null, | 911 | "cache_last_updated": null, | ||
912 | "cache_url": null, | 912 | "cache_url": null, | ||
913 | "created": "2021-11-23T22:17:28.963537", | 913 | "created": "2021-11-23T22:17:28.963537", | ||
914 | "data_collection_info": "n/a", | 914 | "data_collection_info": "n/a", | ||
915 | "data_processing": "n/a", | 915 | "data_processing": "n/a", | ||
916 | "datastore_active": false, | 916 | "datastore_active": false, | ||
917 | "datastore_status": "", | 917 | "datastore_status": "", | ||
918 | "description": "The main purpose of this paper is to provide | 918 | "description": "The main purpose of this paper is to provide | ||
919 | information for what is currently known about the waterbird species | 919 | information for what is currently known about the waterbird species | ||
920 | that utilize Lake Windermere habitat. This report will provide the | 920 | that utilize Lake Windermere habitat. This report will provide the | ||
921 | findings of a single-day bird count conducted on the northern half of | 921 | findings of a single-day bird count conducted on the northern half of | ||
922 | Lake Windermere in September 2018. Lake Windermere bird data retrieved | 922 | Lake Windermere in September 2018. Lake Windermere bird data retrieved | ||
923 | from an online database (eBird) was reviewed and indicates that 165 | 923 | from an online database (eBird) was reviewed and indicates that 165 | ||
924 | bird species have been detected at Lake Windermere, 17 of these | 924 | bird species have been detected at Lake Windermere, 17 of these | ||
925 | species are considered to be at-risk. A review of historic and more | 925 | species are considered to be at-risk. A review of historic and more | ||
926 | recent bird data indicates that Lake Windermere contains important | 926 | recent bird data indicates that Lake Windermere contains important | ||
927 | bird habitat. The south end of the lake consistently has large | 927 | bird habitat. The south end of the lake consistently has large | ||
928 | concentrations of staging waterfowl during migration, and has the | 928 | concentrations of staging waterfowl during migration, and has the | ||
929 | highest single day bird counts resulting from a regional coordinated | 929 | highest single day bird counts resulting from a regional coordinated | ||
930 | bird count (i.e. Columbia Wetlands Waterbird Survey). When compared | 930 | bird count (i.e. Columbia Wetlands Waterbird Survey). When compared | ||
931 | across 105 survey stations in the Columbia Wetlands, the south end of | 931 | across 105 survey stations in the Columbia Wetlands, the south end of | ||
932 | Lake Windermere appears to contain the most important staging area | 932 | Lake Windermere appears to contain the most important staging area | ||
933 | within the continuous wetlands ecosystem for at-risk grebe species, as | 933 | within the continuous wetlands ecosystem for at-risk grebe species, as | ||
934 | well as for other bird species such as American coot. Creek mouths | 934 | well as for other bird species such as American coot. Creek mouths | ||
935 | found at Lake Windermere are also important habitat for birds, | 935 | found at Lake Windermere are also important habitat for birds, | ||
936 | especially for migrating shorebirds. Information on why birds are | 936 | especially for migrating shorebirds. Information on why birds are | ||
937 | important will be presented here, as well as a brief overview on the | 937 | important will be presented here, as well as a brief overview on the | ||
938 | decline of more than one-third of the world\u2019s bird populations. | 938 | decline of more than one-third of the world\u2019s bird populations. | ||
939 | Several suggestions for future action will be provided that may help | 939 | Several suggestions for future action will be provided that may help | ||
940 | to ensure that Lake Windermere continues to provide important habitat | 940 | to ensure that Lake Windermere continues to provide important habitat | ||
941 | to birds. These include: a) conducting additional fall bird surveys on | 941 | to birds. These include: a) conducting additional fall bird surveys on | ||
942 | the lake, b) completing spring breeding bird surveys in order to | 942 | the lake, b) completing spring breeding bird surveys in order to | ||
943 | assess the utilization of the lake area during a critical life history | 943 | assess the utilization of the lake area during a critical life history | ||
944 | stage and to identify and conserve key breeding sites, c) minimizing | 944 | stage and to identify and conserve key breeding sites, c) minimizing | ||
945 | boat traffic in and near nesting, staging, feeding areas during | 945 | boat traffic in and near nesting, staging, feeding areas during | ||
946 | specific times of year, d) public education regarding the importance | 946 | specific times of year, d) public education regarding the importance | ||
947 | of Lake Windermere to birds including at-risk species, and e) marking | 947 | of Lake Windermere to birds including at-risk species, and e) marking | ||
948 | the wildlife management area located at the south end of Lake | 948 | the wildlife management area located at the south end of Lake | ||
949 | Windermere with educational buoys alerting all recreational users of | 949 | Windermere with educational buoys alerting all recreational users of | ||
950 | this boundary (i.e. current legal restrictions make this area | 950 | this boundary (i.e. current legal restrictions make this area | ||
951 | off-limits to motorized water craft). Currently, there are fewer | 951 | off-limits to motorized water craft). Currently, there are fewer | ||
952 | significant wetland areas in the world remaining as habitat for birds. | 952 | significant wetland areas in the world remaining as habitat for birds. | ||
953 | These remaining key areas deserve conservation attention and | 953 | These remaining key areas deserve conservation attention and | ||
954 | recognition.", | 954 | recognition.", | ||
955 | "format": "PDF", | 955 | "format": "PDF", | ||
956 | "hash": "bf1420857dd34dceb70ac95a7802df06", | 956 | "hash": "bf1420857dd34dceb70ac95a7802df06", | ||
957 | "header_row": "", | 957 | "header_row": "", | ||
958 | "id": "6871538d-ae61-46cb-b7bb-0c7d8e2a2bc1", | 958 | "id": "6871538d-ae61-46cb-b7bb-0c7d8e2a2bc1", | ||
959 | "last_modified": "2021-11-23T22:17:28.898335", | 959 | "last_modified": "2021-11-23T22:17:28.898335", | ||
960 | "load_status": "", | 960 | "load_status": "", | ||
n | 961 | "metadata_modified": "2022-05-12T15:25:38.508841", | n | 961 | "metadata_modified": "2022-05-12T15:25:45.750565", |
962 | "mimetype": "application/pdf", | 962 | "mimetype": "application/pdf", | ||
963 | "mimetype_inner": null, | 963 | "mimetype_inner": null, | ||
964 | "name": "Insight into the Waterbirds of Lake Windermere", | 964 | "name": "Insight into the Waterbirds of Lake Windermere", | ||
965 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 965 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
966 | "position": 17, | 966 | "position": 17, | ||
n | 967 | "resource_citation": "Darvill. (2019). Insight into the | n | 967 | "resource_citation": "Darvill (2019). Insight into the |
968 | Waterbirds of Lake Windermere. Prepared for Lake Windermere | 968 | Waterbirds of Lake Windermere. Prepared for Lake Windermere | ||
t | 969 | Ambassadors. Columbia Basin Water Hub [Resource].\u00a0Parson. | t | 969 | Ambassadors. Columbia Basin Water Hub (Resource).\u00a0 Parson. |
970 | https://doi.org/10.48511/KBGB-DJ25", | 970 | (DOI)", | ||
971 | "resource_data_disclaimer": "No warranty or guarantee exists | 971 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
972 | that the information is accurate, complete, current, or suitable for | 972 | that the information is accurate, complete, current, or suitable for | ||
973 | any purpose. The individual user must confirm the accuracy of the data | 973 | any purpose. The individual user must confirm the accuracy of the data | ||
974 | and whether it will be appropriate for their purpose.", | 974 | and whether it will be appropriate for their purpose.", | ||
975 | "resource_location": "Lake Windermere", | 975 | "resource_location": "Lake Windermere", | ||
976 | "resource_type": null, | 976 | "resource_type": null, | ||
977 | "size": 2009958, | 977 | "size": 2009958, | ||
978 | "state": "active", | 978 | "state": "active", | ||
979 | "url": | 979 | "url": | ||
980 | lwa_darvill_report_insightintothewaterbirdsoflakewindermere_2019.pdf", | 980 | lwa_darvill_report_insightintothewaterbirdsoflakewindermere_2019.pdf", | ||
981 | "url_type": "upload", | 981 | "url_type": "upload", | ||
982 | "waterhub_certified": "Certified", | 982 | "waterhub_certified": "Certified", | ||
983 | "waterhub_grade": "People and Perspectives" | 983 | "waterhub_grade": "People and Perspectives" | ||
984 | } | 984 | } | ||
985 | ], | 985 | ], | ||
986 | "start_date": "2009-01-01", | 986 | "start_date": "2009-01-01", | ||
987 | "state": "active", | 987 | "state": "active", | ||
988 | "tags": [ | 988 | "tags": [ | ||
989 | { | 989 | { | ||
990 | "display_name": "Bacteriological", | 990 | "display_name": "Bacteriological", | ||
991 | "id": "b446598e-8ac4-4dce-8eed-3ab2d595aca7", | 991 | "id": "b446598e-8ac4-4dce-8eed-3ab2d595aca7", | ||
992 | "name": "Bacteriological", | 992 | "name": "Bacteriological", | ||
993 | "state": "active", | 993 | "state": "active", | ||
994 | "vocabulary_id": null | 994 | "vocabulary_id": null | ||
995 | }, | 995 | }, | ||
996 | { | 996 | { | ||
997 | "display_name": "CABIN", | 997 | "display_name": "CABIN", | ||
998 | "id": "476e5cf2-3801-40e8-9c73-dac2cedbaf7f", | 998 | "id": "476e5cf2-3801-40e8-9c73-dac2cedbaf7f", | ||
999 | "name": "CABIN", | 999 | "name": "CABIN", | ||
1000 | "state": "active", | 1000 | "state": "active", | ||
1001 | "vocabulary_id": null | 1001 | "vocabulary_id": null | ||
1002 | }, | 1002 | }, | ||
1003 | { | 1003 | { | ||
1004 | "display_name": "Community-based monitoring", | 1004 | "display_name": "Community-based monitoring", | ||
1005 | "id": "9b75240a-5e54-43c9-9063-969983d065f6", | 1005 | "id": "9b75240a-5e54-43c9-9063-969983d065f6", | ||
1006 | "name": "Community-based monitoring", | 1006 | "name": "Community-based monitoring", | ||
1007 | "state": "active", | 1007 | "state": "active", | ||
1008 | "vocabulary_id": null | 1008 | "vocabulary_id": null | ||
1009 | }, | 1009 | }, | ||
1010 | { | 1010 | { | ||
1011 | "display_name": "Fish", | 1011 | "display_name": "Fish", | ||
1012 | "id": "e5dce2fc-ec9c-4a16-83b3-9b1d0f991c12", | 1012 | "id": "e5dce2fc-ec9c-4a16-83b3-9b1d0f991c12", | ||
1013 | "name": "Fish", | 1013 | "name": "Fish", | ||
1014 | "state": "active", | 1014 | "state": "active", | ||
1015 | "vocabulary_id": null | 1015 | "vocabulary_id": null | ||
1016 | }, | 1016 | }, | ||
1017 | { | 1017 | { | ||
1018 | "display_name": "Hydrology", | 1018 | "display_name": "Hydrology", | ||
1019 | "id": "eb52bf78-f171-4c0b-961b-c7a49fed2236", | 1019 | "id": "eb52bf78-f171-4c0b-961b-c7a49fed2236", | ||
1020 | "name": "Hydrology", | 1020 | "name": "Hydrology", | ||
1021 | "state": "active", | 1021 | "state": "active", | ||
1022 | "vocabulary_id": null | 1022 | "vocabulary_id": null | ||
1023 | }, | 1023 | }, | ||
1024 | { | 1024 | { | ||
1025 | "display_name": "Hydrometric", | 1025 | "display_name": "Hydrometric", | ||
1026 | "id": "ae588e2d-8628-4e7f-ad0a-2cbd38adfd76", | 1026 | "id": "ae588e2d-8628-4e7f-ad0a-2cbd38adfd76", | ||
1027 | "name": "Hydrometric", | 1027 | "name": "Hydrometric", | ||
1028 | "state": "active", | 1028 | "state": "active", | ||
1029 | "vocabulary_id": null | 1029 | "vocabulary_id": null | ||
1030 | }, | 1030 | }, | ||
1031 | { | 1031 | { | ||
1032 | "display_name": "Lake", | 1032 | "display_name": "Lake", | ||
1033 | "id": "66dc1292-41ac-45cf-a267-f0d5c8a31826", | 1033 | "id": "66dc1292-41ac-45cf-a267-f0d5c8a31826", | ||
1034 | "name": "Lake", | 1034 | "name": "Lake", | ||
1035 | "state": "active", | 1035 | "state": "active", | ||
1036 | "vocabulary_id": null | 1036 | "vocabulary_id": null | ||
1037 | }, | 1037 | }, | ||
1038 | { | 1038 | { | ||
1039 | "display_name": "People and Perspectives", | 1039 | "display_name": "People and Perspectives", | ||
1040 | "id": "bce02f6f-d09f-4305-8e4e-bfeabaeb3a2c", | 1040 | "id": "bce02f6f-d09f-4305-8e4e-bfeabaeb3a2c", | ||
1041 | "name": "People and Perspectives", | 1041 | "name": "People and Perspectives", | ||
1042 | "state": "active", | 1042 | "state": "active", | ||
1043 | "vocabulary_id": null | 1043 | "vocabulary_id": null | ||
1044 | }, | 1044 | }, | ||
1045 | { | 1045 | { | ||
1046 | "display_name": "Sediment Analysis", | 1046 | "display_name": "Sediment Analysis", | ||
1047 | "id": "7bb5f9ef-401c-4112-8a32-4a31695a3e25", | 1047 | "id": "7bb5f9ef-401c-4112-8a32-4a31695a3e25", | ||
1048 | "name": "Sediment Analysis", | 1048 | "name": "Sediment Analysis", | ||
1049 | "state": "active", | 1049 | "state": "active", | ||
1050 | "vocabulary_id": null | 1050 | "vocabulary_id": null | ||
1051 | }, | 1051 | }, | ||
1052 | { | 1052 | { | ||
1053 | "display_name": "Stream", | 1053 | "display_name": "Stream", | ||
1054 | "id": "208421f0-ebb5-4b32-8111-2ff156803d73", | 1054 | "id": "208421f0-ebb5-4b32-8111-2ff156803d73", | ||
1055 | "name": "Stream", | 1055 | "name": "Stream", | ||
1056 | "state": "active", | 1056 | "state": "active", | ||
1057 | "vocabulary_id": null | 1057 | "vocabulary_id": null | ||
1058 | }, | 1058 | }, | ||
1059 | { | 1059 | { | ||
1060 | "display_name": "Water Quality", | 1060 | "display_name": "Water Quality", | ||
1061 | "id": "12fe3ab5-fdaf-44c5-8167-06c7589d90f3", | 1061 | "id": "12fe3ab5-fdaf-44c5-8167-06c7589d90f3", | ||
1062 | "name": "Water Quality", | 1062 | "name": "Water Quality", | ||
1063 | "state": "active", | 1063 | "state": "active", | ||
1064 | "vocabulary_id": null | 1064 | "vocabulary_id": null | ||
1065 | }, | 1065 | }, | ||
1066 | { | 1066 | { | ||
1067 | "display_name": "Water temperature", | 1067 | "display_name": "Water temperature", | ||
1068 | "id": "0770347d-73eb-4f60-a661-50199f7049c3", | 1068 | "id": "0770347d-73eb-4f60-a661-50199f7049c3", | ||
1069 | "name": "Water temperature", | 1069 | "name": "Water temperature", | ||
1070 | "state": "active", | 1070 | "state": "active", | ||
1071 | "vocabulary_id": null | 1071 | "vocabulary_id": null | ||
1072 | } | 1072 | } | ||
1073 | ], | 1073 | ], | ||
1074 | "title": "Lake Windermere Ambassadors Annual Water Monitoring | 1074 | "title": "Lake Windermere Ambassadors Annual Water Monitoring | ||
1075 | Reports", | 1075 | Reports", | ||
1076 | "type": "dataset", | 1076 | "type": "dataset", | ||
1077 | "url": null, | 1077 | "url": null, | ||
1078 | "version": null | 1078 | "version": null | ||
1079 | } | 1079 | } |