Changes
On March 18, 2022 at 5:43:05 AM UTC, lladmin:
-
No fields were updated. See the metadata diff for more details.
f | 1 | { | f | 1 | { |
2 | "author": null, | 2 | "author": null, | ||
3 | "author_email": null, | 3 | "author_email": null, | ||
4 | "citation": "See individual reports for citation.", | 4 | "citation": "See individual reports for citation.", | ||
5 | "creator": "Lake Windermere Ambassadors", | 5 | "creator": "Lake Windermere Ambassadors", | ||
6 | "creator_user_id": "efbb05c2-ed3c-42ec-894b-cafbb9d5f2db", | 6 | "creator_user_id": "efbb05c2-ed3c-42ec-894b-cafbb9d5f2db", | ||
7 | "data_disclaimer": "No warranty or guarantee exists that the | 7 | "data_disclaimer": "No warranty or guarantee exists that the | ||
8 | information is accurate, complete, current, or suitable for any | 8 | information is accurate, complete, current, or suitable for any | ||
9 | purpose. The individual user must confirm the accuracy of the data and | 9 | purpose. The individual user must confirm the accuracy of the data and | ||
10 | whether it will be appropriate for their purpose.", | 10 | whether it will be appropriate for their purpose.", | ||
11 | "data_type": "Lake", | 11 | "data_type": "Lake", | ||
12 | "end_date": "2020-12-31", | 12 | "end_date": "2020-12-31", | ||
13 | "funding_reference": "See individual reporots for funding | 13 | "funding_reference": "See individual reporots for funding | ||
14 | description.", | 14 | description.", | ||
15 | "groups": [ | 15 | "groups": [ | ||
16 | { | 16 | { | ||
17 | "description": "This group includes all the datasets which fall | 17 | "description": "This group includes all the datasets which fall | ||
18 | within the Columbia-Kootenay Headwaters Hydrologic region ", | 18 | within the Columbia-Kootenay Headwaters Hydrologic region ", | ||
19 | "display_name": "Columbia-Kootenay Headwaters", | 19 | "display_name": "Columbia-Kootenay Headwaters", | ||
20 | "id": "20673d8f-8f40-4e64-9f34-4966d5123705", | 20 | "id": "20673d8f-8f40-4e64-9f34-4966d5123705", | ||
21 | "image_display_url": | 21 | "image_display_url": | ||
22 | rhub.ca/uploads/group/2021-03-02-214610.209659Mapfinalheadwayers.png", | 22 | rhub.ca/uploads/group/2021-03-02-214610.209659Mapfinalheadwayers.png", | ||
23 | "name": "columbia-kootenay-headwaters", | 23 | "name": "columbia-kootenay-headwaters", | ||
24 | "title": "Columbia-Kootenay Headwaters" | 24 | "title": "Columbia-Kootenay Headwaters" | ||
25 | } | 25 | } | ||
26 | ], | 26 | ], | ||
27 | "id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 27 | "id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
28 | "identifier": "", | 28 | "identifier": "", | ||
29 | "isopen": false, | 29 | "isopen": false, | ||
30 | "keywords": "Community-based | 30 | "keywords": "Community-based | ||
31 | monitoring,Hydrology,Hydrometric,Fish,Lake,People and | 31 | monitoring,Hydrology,Hydrometric,Fish,Lake,People and | ||
32 | Perspectives,Water Quality,Stream,Water temperature,Sediment | 32 | Perspectives,Water Quality,Stream,Water temperature,Sediment | ||
33 | Analysis,Bacteriological,CABIN", | 33 | Analysis,Bacteriological,CABIN", | ||
34 | "latitude": "50.472805", | 34 | "latitude": "50.472805", | ||
35 | "license_id": "CC-BY-SA-4.0", | 35 | "license_id": "CC-BY-SA-4.0", | ||
36 | "license_title": "CC-BY-SA-4.0", | 36 | "license_title": "CC-BY-SA-4.0", | ||
37 | "location": "Lake Windermere, Windermere Creek", | 37 | "location": "Lake Windermere, Windermere Creek", | ||
38 | "longitude": "-116.019217", | 38 | "longitude": "-116.019217", | ||
39 | "maintainer": null, | 39 | "maintainer": null, | ||
40 | "maintainer_email": "info@lakeambassadors.ca", | 40 | "maintainer_email": "info@lakeambassadors.ca", | ||
41 | "metadata_created": "2021-11-23T21:03:29.640876", | 41 | "metadata_created": "2021-11-23T21:03:29.640876", | ||
t | 42 | "metadata_modified": "2022-03-18T05:43:04.227462", | t | 42 | "metadata_modified": "2022-03-18T05:43:05.176285", |
43 | "name": | 43 | "name": | ||
44 | "lake-windermere-ambassadors-annual-water-monitoring-reports", | 44 | "lake-windermere-ambassadors-annual-water-monitoring-reports", | ||
45 | "notes": "Included are the annual water monitoring reports from Lake | 45 | "notes": "Included are the annual water monitoring reports from Lake | ||
46 | Windermere and Windermere Creek as well as aquatic invasive plant | 46 | Windermere and Windermere Creek as well as aquatic invasive plant | ||
47 | reports and a report on Lake Windermere water birds.", | 47 | reports and a report on Lake Windermere water birds.", | ||
48 | "num_resources": 18, | 48 | "num_resources": 18, | ||
49 | "num_tags": 12, | 49 | "num_tags": 12, | ||
50 | "organization": { | 50 | "organization": { | ||
51 | "approval_status": "approved", | 51 | "approval_status": "approved", | ||
52 | "created": "2021-05-20T09:58:43.376117", | 52 | "created": "2021-05-20T09:58:43.376117", | ||
53 | "description": "The Lake Windermere Ambassadors are a | 53 | "description": "The Lake Windermere Ambassadors are a | ||
54 | community-based environmental stewardship non-profit working in the | 54 | community-based environmental stewardship non-profit working in the | ||
55 | East Kootenay region of BC. The Ambassadors have a vision of an | 55 | East Kootenay region of BC. The Ambassadors have a vision of an | ||
56 | ecologically healthy Lake Windermere with balanced management | 56 | ecologically healthy Lake Windermere with balanced management | ||
57 | approaches that support recreation and traditional uses, high fish and | 57 | approaches that support recreation and traditional uses, high fish and | ||
58 | wildlife values, and economic prosperity in the region.", | 58 | wildlife values, and economic prosperity in the region.", | ||
59 | "id": "fa6d1422-26e0-4d81-9abc-94f8fb043e7c", | 59 | "id": "fa6d1422-26e0-4d81-9abc-94f8fb043e7c", | ||
60 | "image_url": "2021-05-20-174743.524491Master-Large.png", | 60 | "image_url": "2021-05-20-174743.524491Master-Large.png", | ||
61 | "is_organization": true, | 61 | "is_organization": true, | ||
62 | "name": "lake-windermere", | 62 | "name": "lake-windermere", | ||
63 | "state": "active", | 63 | "state": "active", | ||
64 | "title": "Lake Windermere Ambassadors", | 64 | "title": "Lake Windermere Ambassadors", | ||
65 | "type": "organization" | 65 | "type": "organization" | ||
66 | }, | 66 | }, | ||
67 | "other_sources": "n/a", | 67 | "other_sources": "n/a", | ||
68 | "owner_org": "fa6d1422-26e0-4d81-9abc-94f8fb043e7c", | 68 | "owner_org": "fa6d1422-26e0-4d81-9abc-94f8fb043e7c", | ||
69 | "private": false, | 69 | "private": false, | ||
70 | "publication_year": "2021", | 70 | "publication_year": "2021", | ||
71 | "relationships_as_object": [], | 71 | "relationships_as_object": [], | ||
72 | "relationships_as_subject": [], | 72 | "relationships_as_subject": [], | ||
73 | "resources": [ | 73 | "resources": [ | ||
74 | { | 74 | { | ||
75 | "cache_last_updated": null, | 75 | "cache_last_updated": null, | ||
76 | "cache_url": null, | 76 | "cache_url": null, | ||
77 | "created": "2021-11-23T21:14:26.266170", | 77 | "created": "2021-11-23T21:14:26.266170", | ||
78 | "data_collection_info": "N/A", | 78 | "data_collection_info": "N/A", | ||
79 | "data_processing": "N/A", | 79 | "data_processing": "N/A", | ||
80 | "datastore_active": false, | 80 | "datastore_active": false, | ||
81 | "description": "In 2020, the Lake Windermere Ambassadors | 81 | "description": "In 2020, the Lake Windermere Ambassadors | ||
82 | collected physical and chemical water quality parameters at three | 82 | collected physical and chemical water quality parameters at three | ||
83 | sample sites on Lake Windermere once weekly during the summer, from | 83 | sample sites on Lake Windermere once weekly during the summer, from | ||
84 | late May to September\u200b. The lake sampling regime included water | 84 | late May to September\u200b. The lake sampling regime included water | ||
85 | temperature, turbidity/clarity, pH, conductivity, depth, and dissolved | 85 | temperature, turbidity/clarity, pH, conductivity, depth, and dissolved | ||
86 | oxygen. Once monthly from May to September we collected Total | 86 | oxygen. Once monthly from May to September we collected Total | ||
87 | Dissolved Phosphorus and Total Phosphorous. The LWA monitored | 87 | Dissolved Phosphorus and Total Phosphorous. The LWA monitored | ||
88 | substrate samplers at six sites on the east side of Lake Windermere | 88 | substrate samplers at six sites on the east side of Lake Windermere | ||
89 | for invasive mussels, and monitored tributary flows and water quality | 89 | for invasive mussels, and monitored tributary flows and water quality | ||
90 | at the outlet of Windermere Creek and Abel Creek. \u200bE. coli data | 90 | at the outlet of Windermere Creek and Abel Creek. \u200bE. coli data | ||
91 | was collected at public swim beaches weekly, from May until September, | 91 | was collected at public swim beaches weekly, from May until September, | ||
92 | excluding weeks with a statutory holiday Monday, in partnership with | 92 | excluding weeks with a statutory holiday Monday, in partnership with | ||
93 | the Interior Health Authority.", | 93 | the Interior Health Authority.", | ||
94 | "format": "PDF", | 94 | "format": "PDF", | ||
95 | "hash": "e7a7c3e18b245292c6e847bb9235bbac", | 95 | "hash": "e7a7c3e18b245292c6e847bb9235bbac", | ||
96 | "header_row": "", | 96 | "header_row": "", | ||
97 | "id": "1e59877d-72a2-4fed-bd21-9d613c0e53a5", | 97 | "id": "1e59877d-72a2-4fed-bd21-9d613c0e53a5", | ||
98 | "last_modified": "2021-11-23T21:14:26.212715", | 98 | "last_modified": "2021-11-23T21:14:26.212715", | ||
99 | "metadata_modified": "2021-11-23T21:14:26.266170", | 99 | "metadata_modified": "2021-11-23T21:14:26.266170", | ||
100 | "mimetype": "application/pdf", | 100 | "mimetype": "application/pdf", | ||
101 | "mimetype_inner": null, | 101 | "mimetype_inner": null, | ||
102 | "name": "Water Quality Monitoring Program 2020 Final Report", | 102 | "name": "Water Quality Monitoring Program 2020 Final Report", | ||
103 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 103 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
104 | "position": 0, | 104 | "position": 0, | ||
105 | "resource_citation": "Peck, G (2021). Lake Windermere Community | 105 | "resource_citation": "Peck, G (2021). Lake Windermere Community | ||
106 | Based Water Quality Monitoring Program 2020 Final Report. Prepared for | 106 | Based Water Quality Monitoring Program 2020 Final Report. Prepared for | ||
107 | Lake Windermere Ambassadors. Columbia Basin Water Hub. (Resource). | 107 | Lake Windermere Ambassadors. Columbia Basin Water Hub. (Resource). | ||
108 | Invermere. (DOI)", | 108 | Invermere. (DOI)", | ||
109 | "resource_data_disclaimer": "No warranty or guarantee exists | 109 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
110 | that the information is accurate, complete, current, or suitable for | 110 | that the information is accurate, complete, current, or suitable for | ||
111 | any purpose. The individual user must confirm the accuracy of the data | 111 | any purpose. The individual user must confirm the accuracy of the data | ||
112 | and whether it will be appropriate for their purpose.", | 112 | and whether it will be appropriate for their purpose.", | ||
113 | "resource_location": "Lake Windermere", | 113 | "resource_location": "Lake Windermere", | ||
114 | "resource_type": null, | 114 | "resource_type": null, | ||
115 | "size": 1595807, | 115 | "size": 1595807, | ||
116 | "state": "active", | 116 | "state": "active", | ||
117 | "url": | 117 | "url": | ||
118 | d/lwa_peck_report_lkwindermerewaterqualitymonitoringprogram_2020.pdf", | 118 | d/lwa_peck_report_lkwindermerewaterqualitymonitoringprogram_2020.pdf", | ||
119 | "url_type": "upload", | 119 | "url_type": "upload", | ||
120 | "waterhub_certified": "Certified", | 120 | "waterhub_certified": "Certified", | ||
121 | "waterhub_grade": "People and Perspectives" | 121 | "waterhub_grade": "People and Perspectives" | ||
122 | }, | 122 | }, | ||
123 | { | 123 | { | ||
124 | "cache_last_updated": null, | 124 | "cache_last_updated": null, | ||
125 | "cache_url": null, | 125 | "cache_url": null, | ||
126 | "created": "2021-11-23T21:55:51.837852", | 126 | "created": "2021-11-23T21:55:51.837852", | ||
127 | "data_collection_info": "n/a", | 127 | "data_collection_info": "n/a", | ||
128 | "data_processing": "n/a", | 128 | "data_processing": "n/a", | ||
129 | "datastore_active": false, | 129 | "datastore_active": false, | ||
130 | "description": "In 2019, the Lake Windermere Ambassadors | 130 | "description": "In 2019, the Lake Windermere Ambassadors | ||
131 | collected physical and chemical water quality parameters at three | 131 | collected physical and chemical water quality parameters at three | ||
132 | sample sites on Lake Windermere once weekly during the summer, from | 132 | sample sites on Lake Windermere once weekly during the summer, from | ||
133 | late May to September. The lake sampling regime included water | 133 | late May to September. The lake sampling regime included water | ||
134 | temperature, turbidity/clarity, pH, conductivity, depth, and dissolved | 134 | temperature, turbidity/clarity, pH, conductivity, depth, and dissolved | ||
135 | oxygen. Once monthly from May to September we collected Total | 135 | oxygen. Once monthly from May to September we collected Total | ||
136 | Dissolved Phosphorus and Total Phosphorous. In addition, the LWA | 136 | Dissolved Phosphorus and Total Phosphorous. In addition, the LWA | ||
137 | monitored substrate samplers at six sites on the east side of Lake | 137 | monitored substrate samplers at six sites on the east side of Lake | ||
138 | Windermere for invasive mussels, as well as monitoring tributary flows | 138 | Windermere for invasive mussels, as well as monitoring tributary flows | ||
139 | and water quality at the outlet of Windermere Creek and Abel Creek. E. | 139 | and water quality at the outlet of Windermere Creek and Abel Creek. E. | ||
140 | coli data was collected at public swim beaches weekly, from May until | 140 | coli data was collected at public swim beaches weekly, from May until | ||
141 | September, excluding weeks with a statutory holiday Monday, in | 141 | September, excluding weeks with a statutory holiday Monday, in | ||
142 | partnership with the Interior Health Authority. Lastly, Goldeneye | 142 | partnership with the Interior Health Authority. Lastly, Goldeneye | ||
143 | Ecological Services was contracted to complete an aquatic plant | 143 | Ecological Services was contracted to complete an aquatic plant | ||
144 | survey, and fall waterbird survey on Lake Windermere.", | 144 | survey, and fall waterbird survey on Lake Windermere.", | ||
145 | "format": "PDF", | 145 | "format": "PDF", | ||
146 | "hash": "3d388a54d7dc9fef6df16bd80732492f", | 146 | "hash": "3d388a54d7dc9fef6df16bd80732492f", | ||
147 | "header_row": "", | 147 | "header_row": "", | ||
148 | "id": "d9db0064-520b-4e59-a537-4164219cb5bf", | 148 | "id": "d9db0064-520b-4e59-a537-4164219cb5bf", | ||
149 | "last_modified": "2021-11-23T21:55:51.776932", | 149 | "last_modified": "2021-11-23T21:55:51.776932", | ||
150 | "metadata_modified": "2021-11-23T21:55:51.837852", | 150 | "metadata_modified": "2021-11-23T21:55:51.837852", | ||
151 | "mimetype": "application/pdf", | 151 | "mimetype": "application/pdf", | ||
152 | "mimetype_inner": null, | 152 | "mimetype_inner": null, | ||
153 | "name": "Water Quality Monitoring Program 2019 Final Report", | 153 | "name": "Water Quality Monitoring Program 2019 Final Report", | ||
154 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 154 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
155 | "position": 1, | 155 | "position": 1, | ||
156 | "resource_citation": "McGinty (2019). Lake Windermere Community | 156 | "resource_citation": "McGinty (2019). Lake Windermere Community | ||
157 | Based Water Quality Monitoring Program 2019 Final Report. Prepared for | 157 | Based Water Quality Monitoring Program 2019 Final Report. Prepared for | ||
158 | Lake Windermere Ambassadors. Columbia Basin Water Hub | 158 | Lake Windermere Ambassadors. Columbia Basin Water Hub | ||
159 | (Resource).\u00a0 Invermere. DOI", | 159 | (Resource).\u00a0 Invermere. DOI", | ||
160 | "resource_data_disclaimer": "No warranty or guarantee exists | 160 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
161 | that the information is accurate, complete, current, or suitable for | 161 | that the information is accurate, complete, current, or suitable for | ||
162 | any purpose. The individual user must confirm the accuracy of the data | 162 | any purpose. The individual user must confirm the accuracy of the data | ||
163 | and whether it will be appropriate for their purpose.", | 163 | and whether it will be appropriate for their purpose.", | ||
164 | "resource_location": "Lake Windermere", | 164 | "resource_location": "Lake Windermere", | ||
165 | "resource_type": null, | 165 | "resource_type": null, | ||
166 | "size": 2320463, | 166 | "size": 2320463, | ||
167 | "state": "active", | 167 | "state": "active", | ||
168 | "url": | 168 | "url": | ||
169 | wa_mcginty_report_lkwindermerewaterqualitymonitoringprogram_2019.pdf", | 169 | wa_mcginty_report_lkwindermerewaterqualitymonitoringprogram_2019.pdf", | ||
170 | "url_type": "upload", | 170 | "url_type": "upload", | ||
171 | "waterhub_certified": "Certified", | 171 | "waterhub_certified": "Certified", | ||
172 | "waterhub_grade": "People and Perspectives" | 172 | "waterhub_grade": "People and Perspectives" | ||
173 | }, | 173 | }, | ||
174 | { | 174 | { | ||
175 | "cache_last_updated": null, | 175 | "cache_last_updated": null, | ||
176 | "cache_url": null, | 176 | "cache_url": null, | ||
177 | "created": "2021-11-23T22:24:53.420732", | 177 | "created": "2021-11-23T22:24:53.420732", | ||
178 | "data_collection_info": "n/a", | 178 | "data_collection_info": "n/a", | ||
179 | "data_processing": "n/a", | 179 | "data_processing": "n/a", | ||
180 | "datastore_active": false, | 180 | "datastore_active": false, | ||
181 | "description": "In 2018, the LWA collected physical and chemical | 181 | "description": "In 2018, the LWA collected physical and chemical | ||
182 | water quality parameters at three sample sites on Lake Windermere. | 182 | water quality parameters at three sample sites on Lake Windermere. | ||
183 | Once weekly during the summer from late May to mid-September, the lake | 183 | Once weekly during the summer from late May to mid-September, the lake | ||
184 | sampling regime included: water temperature, turbidity/clarity, pH, | 184 | sampling regime included: water temperature, turbidity/clarity, pH, | ||
185 | conductivity, depth, and dissolved oxygen. Once monthly from April to | 185 | conductivity, depth, and dissolved oxygen. Once monthly from April to | ||
186 | August, we collected samples for Total and Total Dissolved | 186 | August, we collected samples for Total and Total Dissolved | ||
187 | Phosphorous. The LWA also collected E. coli data at public swim | 187 | Phosphorous. The LWA also collected E. coli data at public swim | ||
188 | beaches in partnership with the Interior Health Authority, and | 188 | beaches in partnership with the Interior Health Authority, and | ||
189 | monitored tributary flows and water quality at the outlet of | 189 | monitored tributary flows and water quality at the outlet of | ||
190 | Windermere Creek and Abel Creek. Lastly, we conducted an aquatic plant | 190 | Windermere Creek and Abel Creek. Lastly, we conducted an aquatic plant | ||
191 | survey as well as a fall waterbird survey on Lake Windermere with the | 191 | survey as well as a fall waterbird survey on Lake Windermere with the | ||
192 | help and expertise of Goldeneye Ecological Services.\r\n", | 192 | help and expertise of Goldeneye Ecological Services.\r\n", | ||
193 | "format": "PDF", | 193 | "format": "PDF", | ||
194 | "hash": "7a5d9b8bb4af9de2305cffe8928edd30", | 194 | "hash": "7a5d9b8bb4af9de2305cffe8928edd30", | ||
195 | "header_row": "", | 195 | "header_row": "", | ||
196 | "id": "aa6c989d-266e-4f8c-a666-fed3782c1cb1", | 196 | "id": "aa6c989d-266e-4f8c-a666-fed3782c1cb1", | ||
197 | "last_modified": "2021-11-23T22:24:53.353134", | 197 | "last_modified": "2021-11-23T22:24:53.353134", | ||
198 | "metadata_modified": "2021-11-23T22:24:53.420732", | 198 | "metadata_modified": "2021-11-23T22:24:53.420732", | ||
199 | "mimetype": "application/pdf", | 199 | "mimetype": "application/pdf", | ||
200 | "mimetype_inner": null, | 200 | "mimetype_inner": null, | ||
201 | "name": "Water Quality Monitoring Program 2018 Final Report", | 201 | "name": "Water Quality Monitoring Program 2018 Final Report", | ||
202 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 202 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
203 | "position": 2, | 203 | "position": 2, | ||
204 | "resource_citation": "Rodgers (2018). Lake Windermere | 204 | "resource_citation": "Rodgers (2018). Lake Windermere | ||
205 | Community-Based Water Quality Monitoring Program 2018 Final Report. | 205 | Community-Based Water Quality Monitoring Program 2018 Final Report. | ||
206 | Prepared for Lake Windermere Ambassadors. Columbia Basin Water Hub. | 206 | Prepared for Lake Windermere Ambassadors. Columbia Basin Water Hub. | ||
207 | (Resource). Invermere. (DOI)", | 207 | (Resource). Invermere. (DOI)", | ||
208 | "resource_data_disclaimer": "No warranty or guarantee exists | 208 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
209 | that the information is accurate, complete, current, or suitable for | 209 | that the information is accurate, complete, current, or suitable for | ||
210 | any purpose. The individual user must confirm the accuracy of the data | 210 | any purpose. The individual user must confirm the accuracy of the data | ||
211 | and whether it will be appropriate for their purpose.", | 211 | and whether it will be appropriate for their purpose.", | ||
212 | "resource_location": "Lake Windermere", | 212 | "resource_location": "Lake Windermere", | ||
213 | "resource_type": null, | 213 | "resource_type": null, | ||
214 | "size": 2382873, | 214 | "size": 2382873, | ||
215 | "state": "active", | 215 | "state": "active", | ||
216 | "url": | 216 | "url": | ||
217 | rt_lkwindermerecommunity-basedwaterqualitymonitoringprogram_2018.pdf", | 217 | rt_lkwindermerecommunity-basedwaterqualitymonitoringprogram_2018.pdf", | ||
218 | "url_type": "upload", | 218 | "url_type": "upload", | ||
219 | "waterhub_certified": "Certified", | 219 | "waterhub_certified": "Certified", | ||
220 | "waterhub_grade": "People and Perspectives" | 220 | "waterhub_grade": "People and Perspectives" | ||
221 | }, | 221 | }, | ||
222 | { | 222 | { | ||
223 | "cache_last_updated": null, | 223 | "cache_last_updated": null, | ||
224 | "cache_url": null, | 224 | "cache_url": null, | ||
225 | "created": "2021-11-23T22:37:40.342909", | 225 | "created": "2021-11-23T22:37:40.342909", | ||
226 | "data_collection_info": "n/a", | 226 | "data_collection_info": "n/a", | ||
227 | "data_processing": "n/a", | 227 | "data_processing": "n/a", | ||
228 | "datastore_active": false, | 228 | "datastore_active": false, | ||
229 | "description": "In 2017, the LWA collected physical and chemical | 229 | "description": "In 2017, the LWA collected physical and chemical | ||
230 | water quality parameters at three sample sites on Lake Windermere. | 230 | water quality parameters at three sample sites on Lake Windermere. | ||
231 | Once weekly during the summer from mid-June to mid-September, the lake | 231 | Once weekly during the summer from mid-June to mid-September, the lake | ||
232 | sampling regime included: temperature, turbidity/clarity, pH, | 232 | sampling regime included: temperature, turbidity/clarity, pH, | ||
233 | conductivity, depth, dissolved oxygen, and Total and Dissolved | 233 | conductivity, depth, dissolved oxygen, and Total and Dissolved | ||
234 | Phosphorous. The LWA also collected E. coli data at public swim | 234 | Phosphorous. The LWA also collected E. coli data at public swim | ||
235 | beaches with the support of the Interior Health Authority, and | 235 | beaches with the support of the Interior Health Authority, and | ||
236 | monitored tributary flows and water quality at the outlet of | 236 | monitored tributary flows and water quality at the outlet of | ||
237 | Windermere Creek with the support of the Columbia Basin Water Quality | 237 | Windermere Creek with the support of the Columbia Basin Water Quality | ||
238 | Monitoring Project (CBWQ). Finally, we conducted an aquatic plant and | 238 | Monitoring Project (CBWQ). Finally, we conducted an aquatic plant and | ||
239 | invasive veliger survey with the help and expertise of the East | 239 | invasive veliger survey with the help and expertise of the East | ||
240 | Kootenay Invasive Species Council and Goldeneye Ecological Services.", | 240 | Kootenay Invasive Species Council and Goldeneye Ecological Services.", | ||
241 | "format": "PDF", | 241 | "format": "PDF", | ||
242 | "hash": "", | 242 | "hash": "", | ||
243 | "header_row": "", | 243 | "header_row": "", | ||
244 | "id": "8d13ec2c-6a7b-4dab-bb00-ff525d787063", | 244 | "id": "8d13ec2c-6a7b-4dab-bb00-ff525d787063", | ||
245 | "last_modified": null, | 245 | "last_modified": null, | ||
246 | "metadata_modified": "2021-11-23T22:37:40.342909", | 246 | "metadata_modified": "2021-11-23T22:37:40.342909", | ||
247 | "mimetype": null, | 247 | "mimetype": null, | ||
248 | "mimetype_inner": null, | 248 | "mimetype_inner": null, | ||
249 | "name": "Lake Windermere 2017 Water Quality Monitoring Results", | 249 | "name": "Lake Windermere 2017 Water Quality Monitoring Results", | ||
250 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 250 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
251 | "position": 3, | 251 | "position": 3, | ||
252 | "resource_citation": "Rodgers (2017). Lake Windermere 2017 Water | 252 | "resource_citation": "Rodgers (2017). Lake Windermere 2017 Water | ||
253 | Quality Monitoring Results. Prepared for Lake Windermere Ambassadors. | 253 | Quality Monitoring Results. Prepared for Lake Windermere Ambassadors. | ||
254 | Columbia Basin Water Hub (Resource).\u00a0Invermere (DOI)", | 254 | Columbia Basin Water Hub (Resource).\u00a0Invermere (DOI)", | ||
255 | "resource_data_disclaimer": "No warranty or guarantee exists | 255 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
256 | that the information is accurate, complete, current, or suitable for | 256 | that the information is accurate, complete, current, or suitable for | ||
257 | any purpose. The individual user must confirm the accuracy of the data | 257 | any purpose. The individual user must confirm the accuracy of the data | ||
258 | and whether it will be appropriate for their purpose.", | 258 | and whether it will be appropriate for their purpose.", | ||
259 | "resource_location": "Lake Windermere", | 259 | "resource_location": "Lake Windermere", | ||
260 | "resource_type": null, | 260 | "resource_type": null, | ||
261 | "size": null, | 261 | "size": null, | ||
262 | "state": "active", | 262 | "state": "active", | ||
263 | "url": "", | 263 | "url": "", | ||
264 | "url_type": null, | 264 | "url_type": null, | ||
265 | "waterhub_certified": "Certified", | 265 | "waterhub_certified": "Certified", | ||
266 | "waterhub_grade": "People and Perspectives" | 266 | "waterhub_grade": "People and Perspectives" | ||
267 | }, | 267 | }, | ||
268 | { | 268 | { | ||
269 | "cache_last_updated": null, | 269 | "cache_last_updated": null, | ||
270 | "cache_url": null, | 270 | "cache_url": null, | ||
271 | "created": "2021-11-23T22:49:43.365126", | 271 | "created": "2021-11-23T22:49:43.365126", | ||
272 | "data_collection_info": "n/a", | 272 | "data_collection_info": "n/a", | ||
273 | "data_processing": "n/a", | 273 | "data_processing": "n/a", | ||
274 | "datastore_active": false, | 274 | "datastore_active": false, | ||
275 | "description": "2016 marked the eleventh year of lake monitoring | 275 | "description": "2016 marked the eleventh year of lake monitoring | ||
276 | since the Lake Windermere Project started data collection in 2006. The | 276 | since the Lake Windermere Project started data collection in 2006. The | ||
277 | spring and summer of 2014-2016 brought mild climatic conditions | 277 | spring and summer of 2014-2016 brought mild climatic conditions | ||
278 | without the major flooding events which characterized 2012-2013. | 278 | without the major flooding events which characterized 2012-2013. | ||
279 | Measured lake depths in 2016 were comparable to those in 2006-2008, | 279 | Measured lake depths in 2016 were comparable to those in 2006-2008, | ||
280 | and shallower than average levels in more recent years (2012, 2014). | 280 | and shallower than average levels in more recent years (2012, 2014). | ||
281 | Lake Windermere met Objectives for temperature, dissolved oxygen, and | 281 | Lake Windermere met Objectives for temperature, dissolved oxygen, and | ||
282 | turbidity throughout the summer. This means the water was clear, cool, | 282 | turbidity throughout the summer. This means the water was clear, cool, | ||
283 | and well oxygenated: all in line with historic levels. Beach | 283 | and well oxygenated: all in line with historic levels. Beach | ||
284 | monitoring results showed that shoreline bacteria levels did not | 284 | monitoring results showed that shoreline bacteria levels did not | ||
285 | exceed the recommended Guidelines for safe swimming on any of Lake | 285 | exceed the recommended Guidelines for safe swimming on any of Lake | ||
286 | Windermere\u2019s public beaches over the summer.", | 286 | Windermere\u2019s public beaches over the summer.", | ||
287 | "format": "PDF", | 287 | "format": "PDF", | ||
288 | "hash": "2273882fe388dc8ddcc3350075dccb34", | 288 | "hash": "2273882fe388dc8ddcc3350075dccb34", | ||
289 | "header_row": "", | 289 | "header_row": "", | ||
290 | "id": "f9919c08-5a37-4277-9c64-4fca6cb1e3ed", | 290 | "id": "f9919c08-5a37-4277-9c64-4fca6cb1e3ed", | ||
291 | "last_modified": "2021-11-23T22:49:43.289338", | 291 | "last_modified": "2021-11-23T22:49:43.289338", | ||
292 | "metadata_modified": "2021-11-23T22:49:43.365126", | 292 | "metadata_modified": "2021-11-23T22:49:43.365126", | ||
293 | "mimetype": "application/pdf", | 293 | "mimetype": "application/pdf", | ||
294 | "mimetype_inner": null, | 294 | "mimetype_inner": null, | ||
295 | "name": "Lake Windermere 2016 Water Quality Monitoring Results", | 295 | "name": "Lake Windermere 2016 Water Quality Monitoring Results", | ||
296 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 296 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
297 | "position": 4, | 297 | "position": 4, | ||
298 | "resource_citation": "Peloso (2017). Lake Windermere 2016 Water | 298 | "resource_citation": "Peloso (2017). Lake Windermere 2016 Water | ||
299 | Quality Monitoring Results. Prepared for Lake Windermere Ambassadors. | 299 | Quality Monitoring Results. Prepared for Lake Windermere Ambassadors. | ||
300 | Columbia Basin Water Hub (Resource).\u00a0Invermere. (DOI)\u2028", | 300 | Columbia Basin Water Hub (Resource).\u00a0Invermere. (DOI)\u2028", | ||
301 | "resource_data_disclaimer": "No warranty or guarantee exists | 301 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
302 | that the information is accurate, complete, current, or suitable for | 302 | that the information is accurate, complete, current, or suitable for | ||
303 | any purpose. The individual user must confirm the accuracy of the data | 303 | any purpose. The individual user must confirm the accuracy of the data | ||
304 | and whether it will be appropriate for their purpose.", | 304 | and whether it will be appropriate for their purpose.", | ||
305 | "resource_location": "Lake Windermere", | 305 | "resource_location": "Lake Windermere", | ||
306 | "resource_type": null, | 306 | "resource_type": null, | ||
307 | "size": 1299939, | 307 | "size": 1299939, | ||
308 | "state": "active", | 308 | "state": "active", | ||
309 | "url": | 309 | "url": | ||
310 | loso_report_lakewindermere2016waterqualitymonitoringresults_2016.pdf", | 310 | loso_report_lakewindermere2016waterqualitymonitoringresults_2016.pdf", | ||
311 | "url_type": "upload", | 311 | "url_type": "upload", | ||
312 | "waterhub_certified": "Certified", | 312 | "waterhub_certified": "Certified", | ||
313 | "waterhub_grade": "People and Perspectives" | 313 | "waterhub_grade": "People and Perspectives" | ||
314 | }, | 314 | }, | ||
315 | { | 315 | { | ||
316 | "cache_last_updated": null, | 316 | "cache_last_updated": null, | ||
317 | "cache_url": null, | 317 | "cache_url": null, | ||
318 | "created": "2021-11-23T23:05:34.834141", | 318 | "created": "2021-11-23T23:05:34.834141", | ||
319 | "data_collection_info": "n/a", | 319 | "data_collection_info": "n/a", | ||
320 | "data_processing": "n/a", | 320 | "data_processing": "n/a", | ||
321 | "datastore_active": false, | 321 | "datastore_active": false, | ||
322 | "description": "2015 marked the tenth year of lake monitoring | 322 | "description": "2015 marked the tenth year of lake monitoring | ||
323 | since the Lake Windermere Project started data collection in 2006. The | 323 | since the Lake Windermere Project started data collection in 2006. The | ||
324 | spring and summer of 2014 and 2015 brought mild climatic conditions | 324 | spring and summer of 2014 and 2015 brought mild climatic conditions | ||
325 | without the major flooding events which characterized 2012 and 2013. | 325 | without the major flooding events which characterized 2012 and 2013. | ||
326 | Measured lake depths in 2015 were comparable to those in 2006-2008, | 326 | Measured lake depths in 2015 were comparable to those in 2006-2008, | ||
327 | and shallower than average levels in more recent years (2012, 2014). | 327 | and shallower than average levels in more recent years (2012, 2014). | ||
328 | Lake Windermere met Objectives for temperature, dissolved oxygen, and | 328 | Lake Windermere met Objectives for temperature, dissolved oxygen, and | ||
329 | turbidity throughout the summer. This means the water was clear, cool, | 329 | turbidity throughout the summer. This means the water was clear, cool, | ||
330 | and well oxygenated: all in line with historic levels. Beach | 330 | and well oxygenated: all in line with historic levels. Beach | ||
331 | monitoring results show that shoreline bacteria levels did not exceed | 331 | monitoring results show that shoreline bacteria levels did not exceed | ||
332 | the recommended Guidelines for safe swimming on any of Lake | 332 | the recommended Guidelines for safe swimming on any of Lake | ||
333 | Windermere\u2019s public beaches over the summer.\r\nTotal phosphorus | 333 | Windermere\u2019s public beaches over the summer.\r\nTotal phosphorus | ||
334 | levels at ice-off exceeded the Objective for the Lake at two sampling | 334 | levels at ice-off exceeded the Objective for the Lake at two sampling | ||
335 | stations in 2015. A slight increasing trend in this nutrient has been | 335 | stations in 2015. A slight increasing trend in this nutrient has been | ||
336 | observed in the lake in recent years, warranting continued monitoring | 336 | observed in the lake in recent years, warranting continued monitoring | ||
337 | in conjunction with efforts on land to keep excess nutrients out of | 337 | in conjunction with efforts on land to keep excess nutrients out of | ||
338 | the lake.", | 338 | the lake.", | ||
339 | "format": "PDF", | 339 | "format": "PDF", | ||
340 | "hash": "0a33c447193b2f26f74036fde504639c", | 340 | "hash": "0a33c447193b2f26f74036fde504639c", | ||
341 | "header_row": "", | 341 | "header_row": "", | ||
342 | "id": "d27e444f-a734-4e40-bc8d-56fc4f3f4755", | 342 | "id": "d27e444f-a734-4e40-bc8d-56fc4f3f4755", | ||
343 | "last_modified": "2021-11-23T23:05:34.756954", | 343 | "last_modified": "2021-11-23T23:05:34.756954", | ||
344 | "metadata_modified": "2021-11-23T23:05:34.834141", | 344 | "metadata_modified": "2021-11-23T23:05:34.834141", | ||
345 | "mimetype": "application/pdf", | 345 | "mimetype": "application/pdf", | ||
346 | "mimetype_inner": null, | 346 | "mimetype_inner": null, | ||
347 | "name": "Lake Windermere 2015 Water Quality Monitoring Results", | 347 | "name": "Lake Windermere 2015 Water Quality Monitoring Results", | ||
348 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 348 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
349 | "position": 5, | 349 | "position": 5, | ||
350 | "resource_citation": "Peloso (2016). Lake Windermere 2015 Water | 350 | "resource_citation": "Peloso (2016). Lake Windermere 2015 Water | ||
351 | Quality Monitoring Results. Prepared for Lake Windermere Ambassadors. | 351 | Quality Monitoring Results. Prepared for Lake Windermere Ambassadors. | ||
352 | Columbia Basin Water Hub (Resource).\u00a0Invermere. (DOI)\u2028", | 352 | Columbia Basin Water Hub (Resource).\u00a0Invermere. (DOI)\u2028", | ||
353 | "resource_data_disclaimer": "No warranty or guarantee exists | 353 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
354 | that the information is accurate, complete, current, or suitable for | 354 | that the information is accurate, complete, current, or suitable for | ||
355 | any purpose. The individual user must confirm the accuracy of the data | 355 | any purpose. The individual user must confirm the accuracy of the data | ||
356 | and whether it will be appropriate for their purpose.", | 356 | and whether it will be appropriate for their purpose.", | ||
357 | "resource_location": "Lake Windermere", | 357 | "resource_location": "Lake Windermere", | ||
358 | "resource_type": null, | 358 | "resource_type": null, | ||
359 | "size": 1182081, | 359 | "size": 1182081, | ||
360 | "state": "active", | 360 | "state": "active", | ||
361 | "url": | 361 | "url": | ||
362 | peloso_report_lkwindermere2015waterqualitymonitoringresults_2015.pdf", | 362 | peloso_report_lkwindermere2015waterqualitymonitoringresults_2015.pdf", | ||
363 | "url_type": "upload", | 363 | "url_type": "upload", | ||
364 | "waterhub_certified": "Certified", | 364 | "waterhub_certified": "Certified", | ||
365 | "waterhub_grade": "People and Perspectives" | 365 | "waterhub_grade": "People and Perspectives" | ||
366 | }, | 366 | }, | ||
367 | { | 367 | { | ||
368 | "cache_last_updated": null, | 368 | "cache_last_updated": null, | ||
369 | "cache_url": null, | 369 | "cache_url": null, | ||
370 | "created": "2021-11-23T23:13:35.771622", | 370 | "created": "2021-11-23T23:13:35.771622", | ||
371 | "data_collection_info": "n/a", | 371 | "data_collection_info": "n/a", | ||
372 | "data_processing": "n/a", | 372 | "data_processing": "n/a", | ||
373 | "datastore_active": false, | 373 | "datastore_active": false, | ||
374 | "description": "The spring and summer of 2014 brought mild | 374 | "description": "The spring and summer of 2014 brought mild | ||
375 | climatic conditions without the major flooding events which | 375 | climatic conditions without the major flooding events which | ||
376 | characterized 2012 and 2013. The measured lake depths in 2014 were | 376 | characterized 2012 and 2013. The measured lake depths in 2014 were | ||
377 | comparable to those in 2012, and deeper than average levels between | 377 | comparable to those in 2012, and deeper than average levels between | ||
378 | 2006-2008 and 2011. Lake Windermere met Objectives for temperature, | 378 | 2006-2008 and 2011. Lake Windermere met Objectives for temperature, | ||
379 | dissolved oxygen, and turbidity throughout the summer. This means the | 379 | dissolved oxygen, and turbidity throughout the summer. This means the | ||
380 | water was clear, cool, and well oxygenated: all in line with historic | 380 | water was clear, cool, and well oxygenated: all in line with historic | ||
381 | levels. The beaches were clean in 2014. Measured beach bacteria levels | 381 | levels. The beaches were clean in 2014. Measured beach bacteria levels | ||
382 | did not exceed the recommended Guidelines for safe swimming on any of | 382 | did not exceed the recommended Guidelines for safe swimming on any of | ||
383 | the public beaches over the summer.\r\nTotal phosphorus levels | 383 | the public beaches over the summer.\r\nTotal phosphorus levels | ||
384 | exceeded the Objective for the Lake at one sampling station in 2014. A | 384 | exceeded the Objective for the Lake at one sampling station in 2014. A | ||
385 | slight increasing trend in this nutrient has been observed in the lake | 385 | slight increasing trend in this nutrient has been observed in the lake | ||
386 | in recent years, warranting close monitoring of this critical nutrient | 386 | in recent years, warranting close monitoring of this critical nutrient | ||
387 | and continued efforts on land to keep excess nutrients out of the | 387 | and continued efforts on land to keep excess nutrients out of the | ||
388 | lake.", | 388 | lake.", | ||
389 | "format": "PDF", | 389 | "format": "PDF", | ||
390 | "hash": "e334758dfd79acfeccd9491fa45c4147", | 390 | "hash": "e334758dfd79acfeccd9491fa45c4147", | ||
391 | "header_row": "", | 391 | "header_row": "", | ||
392 | "id": "7c715f2d-aeb5-416d-b153-98e7e9b6c60c", | 392 | "id": "7c715f2d-aeb5-416d-b153-98e7e9b6c60c", | ||
393 | "last_modified": "2021-12-08T21:32:37.277837", | 393 | "last_modified": "2021-12-08T21:32:37.277837", | ||
394 | "metadata_modified": "2021-11-23T23:13:35.771622", | 394 | "metadata_modified": "2021-11-23T23:13:35.771622", | ||
395 | "mimetype": "application/pdf", | 395 | "mimetype": "application/pdf", | ||
396 | "mimetype_inner": null, | 396 | "mimetype_inner": null, | ||
397 | "name": "Lake Windermere 2014 Water Quality Monitoring Results", | 397 | "name": "Lake Windermere 2014 Water Quality Monitoring Results", | ||
398 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 398 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
399 | "position": 6, | 399 | "position": 6, | ||
400 | "resource_citation": "Harma (2014). Lake Windermere 2014 Water | 400 | "resource_citation": "Harma (2014). Lake Windermere 2014 Water | ||
401 | Quality Monitoring Results. Prepared for Lake Windermere Ambassadors. | 401 | Quality Monitoring Results. Prepared for Lake Windermere Ambassadors. | ||
402 | Columbia Basin Water Hub (Resource).\u00a0Invermere. (DOI)\u2028", | 402 | Columbia Basin Water Hub (Resource).\u00a0Invermere. (DOI)\u2028", | ||
403 | "resource_data_disclaimer": "No warranty or guarantee exists | 403 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
404 | that the information is accurate, complete, current, or suitable for | 404 | that the information is accurate, complete, current, or suitable for | ||
405 | any purpose. The individual user must confirm the accuracy of the data | 405 | any purpose. The individual user must confirm the accuracy of the data | ||
406 | and whether it will be appropriate for their purpose.", | 406 | and whether it will be appropriate for their purpose.", | ||
407 | "resource_location": "Lake Windermere", | 407 | "resource_location": "Lake Windermere", | ||
408 | "resource_type": null, | 408 | "resource_type": null, | ||
409 | "size": 857404, | 409 | "size": 857404, | ||
410 | "state": "active", | 410 | "state": "active", | ||
411 | "url": | 411 | "url": | ||
412 | _harma_report_lkwindermere2014waterqualitymonitoringresults_2014.pdf", | 412 | _harma_report_lkwindermere2014waterqualitymonitoringresults_2014.pdf", | ||
413 | "url_type": "upload", | 413 | "url_type": "upload", | ||
414 | "waterhub_certified": "Certified", | 414 | "waterhub_certified": "Certified", | ||
415 | "waterhub_grade": "People and Perspectives" | 415 | "waterhub_grade": "People and Perspectives" | ||
416 | }, | 416 | }, | ||
417 | { | 417 | { | ||
418 | "cache_last_updated": null, | 418 | "cache_last_updated": null, | ||
419 | "cache_url": null, | 419 | "cache_url": null, | ||
420 | "created": "2021-11-23T23:20:00.004349", | 420 | "created": "2021-11-23T23:20:00.004349", | ||
421 | "data_collection_info": "n/a", | 421 | "data_collection_info": "n/a", | ||
422 | "data_processing": "n/a", | 422 | "data_processing": "n/a", | ||
423 | "datastore_active": false, | 423 | "datastore_active": false, | ||
424 | "description": "In 2013, Lake Windermere Ambassadors\u2019 | 424 | "description": "In 2013, Lake Windermere Ambassadors\u2019 | ||
425 | volunteers and staff sampled lake water at three locations monitored | 425 | volunteers and staff sampled lake water at three locations monitored | ||
426 | historically by the Ministry of Environment and then by the Lake | 426 | historically by the Ministry of Environment and then by the Lake | ||
427 | Windermere Project. The sites cover the North and South end and center | 427 | Windermere Project. The sites cover the North and South end and center | ||
428 | (Mid) of the lake.", | 428 | (Mid) of the lake.", | ||
429 | "format": "PDF", | 429 | "format": "PDF", | ||
430 | "hash": "bdb58a784524585c0227d709834fcbf6", | 430 | "hash": "bdb58a784524585c0227d709834fcbf6", | ||
431 | "header_row": "", | 431 | "header_row": "", | ||
432 | "id": "c7780c0f-2ffd-4ed9-96b1-c2f502aebf94", | 432 | "id": "c7780c0f-2ffd-4ed9-96b1-c2f502aebf94", | ||
433 | "last_modified": "2021-11-23T23:19:59.923080", | 433 | "last_modified": "2021-11-23T23:19:59.923080", | ||
434 | "metadata_modified": "2021-11-23T23:20:00.004349", | 434 | "metadata_modified": "2021-11-23T23:20:00.004349", | ||
435 | "mimetype": "application/pdf", | 435 | "mimetype": "application/pdf", | ||
436 | "mimetype_inner": null, | 436 | "mimetype_inner": null, | ||
437 | "name": "Lake Windermere 2013 Water Quality Monitoring Results", | 437 | "name": "Lake Windermere 2013 Water Quality Monitoring Results", | ||
438 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 438 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
439 | "position": 7, | 439 | "position": 7, | ||
440 | "resource_citation": "Lake Windermere Ambassadors (2013). Lake | 440 | "resource_citation": "Lake Windermere Ambassadors (2013). Lake | ||
441 | Windermere 2013 Water Quality Monitoring Results. Columbia Basin Water | 441 | Windermere 2013 Water Quality Monitoring Results. Columbia Basin Water | ||
442 | Hub (Resource).\u00a0Invermere. (DOI)\u2028", | 442 | Hub (Resource).\u00a0Invermere. (DOI)\u2028", | ||
443 | "resource_data_disclaimer": "No warranty or guarantee exists | 443 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
444 | that the information is accurate, complete, current, or suitable for | 444 | that the information is accurate, complete, current, or suitable for | ||
445 | any purpose. The individual user must confirm the accuracy of the data | 445 | any purpose. The individual user must confirm the accuracy of the data | ||
446 | and whether it will be appropriate for their purpose.", | 446 | and whether it will be appropriate for their purpose.", | ||
447 | "resource_location": "Lake Windermere", | 447 | "resource_location": "Lake Windermere", | ||
448 | "resource_type": null, | 448 | "resource_type": null, | ||
449 | "size": 1093839, | 449 | "size": 1093839, | ||
450 | "state": "active", | 450 | "state": "active", | ||
451 | "url": | 451 | "url": | ||
452 | sadors_report_lkwindermere2013waterqualitymonitoringresults_2013.pdf", | 452 | sadors_report_lkwindermere2013waterqualitymonitoringresults_2013.pdf", | ||
453 | "url_type": "upload", | 453 | "url_type": "upload", | ||
454 | "waterhub_certified": "Certified", | 454 | "waterhub_certified": "Certified", | ||
455 | "waterhub_grade": "People and Perspectives" | 455 | "waterhub_grade": "People and Perspectives" | ||
456 | }, | 456 | }, | ||
457 | { | 457 | { | ||
458 | "cache_last_updated": null, | 458 | "cache_last_updated": null, | ||
459 | "cache_url": null, | 459 | "cache_url": null, | ||
460 | "created": "2021-11-23T23:23:42.836926", | 460 | "created": "2021-11-23T23:23:42.836926", | ||
461 | "data_collection_info": "n/a", | 461 | "data_collection_info": "n/a", | ||
462 | "data_processing": "n/a", | 462 | "data_processing": "n/a", | ||
463 | "datastore_active": false, | 463 | "datastore_active": false, | ||
464 | "description": "In 2012 Lake Windermere Ambassadors\u2019 | 464 | "description": "In 2012 Lake Windermere Ambassadors\u2019 | ||
465 | volunteers and staff sampled lake water at three locations established | 465 | volunteers and staff sampled lake water at three locations established | ||
466 | by the Ministry of Environment and sampled over 5 years by the Lake | 466 | by the Ministry of Environment and sampled over 5 years by the Lake | ||
467 | Windermere Project. The sites cover the north and south end and center | 467 | Windermere Project. The sites cover the north and south end and center | ||
468 | of the lake.", | 468 | of the lake.", | ||
469 | "format": "PDF", | 469 | "format": "PDF", | ||
470 | "hash": "ad2d38e5d5b1caffd6a5abfe4c726287", | 470 | "hash": "ad2d38e5d5b1caffd6a5abfe4c726287", | ||
471 | "header_row": "", | 471 | "header_row": "", | ||
472 | "id": "67b8ff61-5811-4c87-bce3-86c79e22822b", | 472 | "id": "67b8ff61-5811-4c87-bce3-86c79e22822b", | ||
473 | "last_modified": "2021-11-23T23:23:42.751096", | 473 | "last_modified": "2021-11-23T23:23:42.751096", | ||
474 | "metadata_modified": "2021-11-23T23:23:42.836926", | 474 | "metadata_modified": "2021-11-23T23:23:42.836926", | ||
475 | "mimetype": "application/pdf", | 475 | "mimetype": "application/pdf", | ||
476 | "mimetype_inner": null, | 476 | "mimetype_inner": null, | ||
477 | "name": "Lake Windermere 2012 Water Quality Monitoring Results", | 477 | "name": "Lake Windermere 2012 Water Quality Monitoring Results", | ||
478 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 478 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
479 | "position": 8, | 479 | "position": 8, | ||
480 | "resource_citation": "Lake Windermere Ambassadors (2012). Lake | 480 | "resource_citation": "Lake Windermere Ambassadors (2012). Lake | ||
481 | Windermere 2012 Water Quality Monitoring Results. Columbia Basin Water | 481 | Windermere 2012 Water Quality Monitoring Results. Columbia Basin Water | ||
482 | Hub (Resource).\u00a0Invermere. (DOI)\u2028", | 482 | Hub (Resource).\u00a0Invermere. (DOI)\u2028", | ||
483 | "resource_data_disclaimer": "No warranty or guarantee exists | 483 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
484 | that the information is accurate, complete, current, or suitable for | 484 | that the information is accurate, complete, current, or suitable for | ||
485 | any purpose. The individual user must confirm the accuracy of the data | 485 | any purpose. The individual user must confirm the accuracy of the data | ||
486 | and whether it will be appropriate for their purpose.", | 486 | and whether it will be appropriate for their purpose.", | ||
487 | "resource_location": "Lake Windermere", | 487 | "resource_location": "Lake Windermere", | ||
488 | "resource_type": null, | 488 | "resource_type": null, | ||
489 | "size": 1603461, | 489 | "size": 1603461, | ||
490 | "state": "active", | 490 | "state": "active", | ||
491 | "url": | 491 | "url": | ||
492 | sadors_report_lkwindermere2012waterqualitymonitoringresults_2012.pdf", | 492 | sadors_report_lkwindermere2012waterqualitymonitoringresults_2012.pdf", | ||
493 | "url_type": "upload", | 493 | "url_type": "upload", | ||
494 | "waterhub_certified": "Certified", | 494 | "waterhub_certified": "Certified", | ||
495 | "waterhub_grade": "People and Perspectives" | 495 | "waterhub_grade": "People and Perspectives" | ||
496 | }, | 496 | }, | ||
497 | { | 497 | { | ||
498 | "cache_last_updated": null, | 498 | "cache_last_updated": null, | ||
499 | "cache_url": null, | 499 | "cache_url": null, | ||
500 | "created": "2021-11-23T23:27:43.105066", | 500 | "created": "2021-11-23T23:27:43.105066", | ||
501 | "data_collection_info": "n/a", | 501 | "data_collection_info": "n/a", | ||
502 | "data_processing": "n/a", | 502 | "data_processing": "n/a", | ||
503 | "datastore_active": false, | 503 | "datastore_active": false, | ||
504 | "description": "In 2011 Lake Windermere Ambassadors\u2019 | 504 | "description": "In 2011 Lake Windermere Ambassadors\u2019 | ||
505 | volunteers and staff sampled lake water at three locations established | 505 | volunteers and staff sampled lake water at three locations established | ||
506 | by the Ministry of Environment and sampled over the previous 5 years | 506 | by the Ministry of Environment and sampled over the previous 5 years | ||
507 | by the Lake Windermere Project. The sites cover the north and south | 507 | by the Lake Windermere Project. The sites cover the north and south | ||
508 | end and center of the lake.", | 508 | end and center of the lake.", | ||
509 | "format": "PDF", | 509 | "format": "PDF", | ||
510 | "hash": "2f17535074d077048b73718bf4fc99ed", | 510 | "hash": "2f17535074d077048b73718bf4fc99ed", | ||
511 | "header_row": "", | 511 | "header_row": "", | ||
512 | "id": "dcf1f2c2-9ce2-4bc3-a8c8-7b0719be9dd5", | 512 | "id": "dcf1f2c2-9ce2-4bc3-a8c8-7b0719be9dd5", | ||
513 | "last_modified": "2021-11-23T23:27:43.016982", | 513 | "last_modified": "2021-11-23T23:27:43.016982", | ||
514 | "load_status": "Invalid header row: ", | 514 | "load_status": "Invalid header row: ", | ||
515 | "metadata_modified": "2021-11-23T23:27:43.105066", | 515 | "metadata_modified": "2021-11-23T23:27:43.105066", | ||
516 | "mimetype": "application/pdf", | 516 | "mimetype": "application/pdf", | ||
517 | "mimetype_inner": null, | 517 | "mimetype_inner": null, | ||
518 | "name": "Lake Windermere 2011 Water Quality Monitoring Results", | 518 | "name": "Lake Windermere 2011 Water Quality Monitoring Results", | ||
519 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 519 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
520 | "position": 9, | 520 | "position": 9, | ||
521 | "resource_citation": "Lake Windermere Ambassadors (2011). Lake | 521 | "resource_citation": "Lake Windermere Ambassadors (2011). Lake | ||
522 | Windermere 2011 Water Quality Monitoring Results. Columbia Basin | 522 | Windermere 2011 Water Quality Monitoring Results. Columbia Basin | ||
523 | Water Hub (Resource).\u00a0Invermere. (DOI)\u2028", | 523 | Water Hub (Resource).\u00a0Invermere. (DOI)\u2028", | ||
524 | "resource_data_disclaimer": "No warranty or guarantee exists | 524 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
525 | that the information is accurate, complete, current, or suitable for | 525 | that the information is accurate, complete, current, or suitable for | ||
526 | any purpose. The individual user must confirm the accuracy of the data | 526 | any purpose. The individual user must confirm the accuracy of the data | ||
527 | and whether it will be appropriate for their purpose.", | 527 | and whether it will be appropriate for their purpose.", | ||
528 | "resource_location": "Lake Windermere", | 528 | "resource_location": "Lake Windermere", | ||
529 | "resource_type": null, | 529 | "resource_type": null, | ||
530 | "size": 1593707, | 530 | "size": 1593707, | ||
531 | "state": "active", | 531 | "state": "active", | ||
532 | "url": | 532 | "url": | ||
533 | sadors_report_lkwindermere2011waterqualitymonitoringresults_2011.pdf", | 533 | sadors_report_lkwindermere2011waterqualitymonitoringresults_2011.pdf", | ||
534 | "url_type": "upload", | 534 | "url_type": "upload", | ||
535 | "waterhub_certified": "Certified", | 535 | "waterhub_certified": "Certified", | ||
536 | "waterhub_grade": "Not Reviewed" | 536 | "waterhub_grade": "Not Reviewed" | ||
537 | }, | 537 | }, | ||
538 | { | 538 | { | ||
539 | "cache_last_updated": null, | 539 | "cache_last_updated": null, | ||
540 | "cache_url": null, | 540 | "cache_url": null, | ||
541 | "created": "2021-11-23T23:35:04.672563", | 541 | "created": "2021-11-23T23:35:04.672563", | ||
542 | "data_collection_info": "n/a", | 542 | "data_collection_info": "n/a", | ||
543 | "data_processing": "n/a", | 543 | "data_processing": "n/a", | ||
544 | "datastore_active": false, | 544 | "datastore_active": false, | ||
545 | "description": "The objectives of this water quality monitoring | 545 | "description": "The objectives of this water quality monitoring | ||
546 | report are as follows:\r\n1. Present CABIN, sediment and water | 546 | report are as follows:\r\n1. Present CABIN, sediment and water | ||
547 | quality, and continual stream temperature data collected to date in a | 547 | quality, and continual stream temperature data collected to date in a | ||
548 | format that can be used for analysis and ongoing assessment.\r\n2. | 548 | format that can be used for analysis and ongoing assessment.\r\n2. | ||
549 | Analyse biological monitoring data (CABIN). Complete the analysis | 549 | Analyse biological monitoring data (CABIN). Complete the analysis | ||
550 | using the analytical tools in the CABIN database by classifying | 550 | using the analytical tools in the CABIN database by classifying | ||
551 | benthic invertebrate community stress at sampling sites according the | 551 | benthic invertebrate community stress at sampling sites according the | ||
552 | Reference Condition Approach and calculating invertebrate community | 552 | Reference Condition Approach and calculating invertebrate community | ||
553 | metrics.\r\n3. Analyse water and sediment quality data to identify if | 553 | metrics.\r\n3. Analyse water and sediment quality data to identify if | ||
554 | there were any parameters of potential concern in the study area. | 554 | there were any parameters of potential concern in the study area. | ||
555 | Complete this review by comparing monitoring results to applicable | 555 | Complete this review by comparing monitoring results to applicable | ||
556 | federal and provincial guidelines for the protection of aquatic life | 556 | federal and provincial guidelines for the protection of aquatic life | ||
557 | and drinking water, where available.\r\n4. Analyse stream temperature | 557 | and drinking water, where available.\r\n4. Analyse stream temperature | ||
558 | data obtained from the continual data logger(s).\r\n5. Relate | 558 | data obtained from the continual data logger(s).\r\n5. Relate | ||
559 | biological results to water/sediment quality and stream temperature | 559 | biological results to water/sediment quality and stream temperature | ||
560 | findings.\r\n6. Provide recommendations for future stream health data | 560 | findings.\r\n6. Provide recommendations for future stream health data | ||
561 | collection including applicable data to be collected, locations to be | 561 | collection including applicable data to be collected, locations to be | ||
562 | sampled, and procedures.", | 562 | sampled, and procedures.", | ||
563 | "format": "PDF", | 563 | "format": "PDF", | ||
564 | "hash": "04badeed083a9d66712fcc286d31092d", | 564 | "hash": "04badeed083a9d66712fcc286d31092d", | ||
565 | "header_row": "", | 565 | "header_row": "", | ||
566 | "id": "121fbbc0-d5cc-4ac2-ad41-e9f00e2eba47", | 566 | "id": "121fbbc0-d5cc-4ac2-ad41-e9f00e2eba47", | ||
567 | "last_modified": "2021-11-23T23:35:04.581894", | 567 | "last_modified": "2021-11-23T23:35:04.581894", | ||
568 | "metadata_modified": "2021-11-23T23:35:04.672563", | 568 | "metadata_modified": "2021-11-23T23:35:04.672563", | ||
569 | "mimetype": "application/pdf", | 569 | "mimetype": "application/pdf", | ||
570 | "mimetype_inner": null, | 570 | "mimetype_inner": null, | ||
571 | "name": "Water Quality Monitoring Report 2009 \u2013 2012", | 571 | "name": "Water Quality Monitoring Report 2009 \u2013 2012", | ||
572 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 572 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
573 | "position": 10, | 573 | "position": 10, | ||
574 | "resource_citation": "McPherson, S., K. Kuchapski, and R. | 574 | "resource_citation": "McPherson, S., K. Kuchapski, and R. | ||
575 | MacDonald. 2014. Windermere Creek 2009-2012, water quality monitoring | 575 | MacDonald. 2014. Windermere Creek 2009-2012, water quality monitoring | ||
576 | report. A Columbia Basin Water Quality Monitoring Project. Prepared by | 576 | report. A Columbia Basin Water Quality Monitoring Project. Prepared by | ||
577 | Lotic Environmental Ltd. for Wildsight.", | 577 | Lotic Environmental Ltd. for Wildsight.", | ||
578 | "resource_data_disclaimer": "No warranty or guarantee exists | 578 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
579 | that the information is accurate, complete, current, or suitable for | 579 | that the information is accurate, complete, current, or suitable for | ||
580 | any purpose. The individual user must confirm the accuracy of the data | 580 | any purpose. The individual user must confirm the accuracy of the data | ||
581 | and whether it will be appropriate for their purpose.", | 581 | and whether it will be appropriate for their purpose.", | ||
582 | "resource_location": "Windermere Creek", | 582 | "resource_location": "Windermere Creek", | ||
583 | "resource_type": null, | 583 | "resource_type": null, | ||
584 | "size": 1166753, | 584 | "size": 1166753, | ||
585 | "state": "active", | 585 | "state": "active", | ||
586 | "url": | 586 | "url": | ||
587 | ntal_report_windermerecreekwaterqualitymonitoringreport2009_2012.pdf", | 587 | ntal_report_windermerecreekwaterqualitymonitoringreport2009_2012.pdf", | ||
588 | "url_type": "upload", | 588 | "url_type": "upload", | ||
589 | "waterhub_certified": "Certified", | 589 | "waterhub_certified": "Certified", | ||
590 | "waterhub_grade": "People and Perspectives" | 590 | "waterhub_grade": "People and Perspectives" | ||
591 | }, | 591 | }, | ||
592 | { | 592 | { | ||
593 | "cache_last_updated": null, | 593 | "cache_last_updated": null, | ||
594 | "cache_url": null, | 594 | "cache_url": null, | ||
595 | "created": "2021-11-23T21:47:42.044031", | 595 | "created": "2021-11-23T21:47:42.044031", | ||
596 | "data_collection_info": "n/a", | 596 | "data_collection_info": "n/a", | ||
597 | "data_processing": "n/a", | 597 | "data_processing": "n/a", | ||
598 | "datastore_active": false, | 598 | "datastore_active": false, | ||
599 | "description": "Data and information included in this report is | 599 | "description": "Data and information included in this report is | ||
600 | a first and preliminary examination of results from Windermere Creek | 600 | a first and preliminary examination of results from Windermere Creek | ||
601 | (BC), which consists of a list of the macroinvertebrate taxa detected | 601 | (BC), which consists of a list of the macroinvertebrate taxa detected | ||
602 | within the samples submitted. This report aims to highlight the | 602 | within the samples submitted. This report aims to highlight the | ||
603 | different macroinvertebrate EPT taxa and provide basic richness | 603 | different macroinvertebrate EPT taxa and provide basic richness | ||
604 | metrics as a useful contribution for community groups to assess river | 604 | metrics as a useful contribution for community groups to assess river | ||
605 | health.", | 605 | health.", | ||
606 | "format": "PDF", | 606 | "format": "PDF", | ||
607 | "hash": "5a1afd2f11385df53ebcddc0131d43f9", | 607 | "hash": "5a1afd2f11385df53ebcddc0131d43f9", | ||
608 | "header_row": "", | 608 | "header_row": "", | ||
609 | "id": "04d7f4c8-f731-4980-aa59-8c8a1a0db5bf", | 609 | "id": "04d7f4c8-f731-4980-aa59-8c8a1a0db5bf", | ||
610 | "last_modified": "2021-11-23T21:47:41.981461", | 610 | "last_modified": "2021-11-23T21:47:41.981461", | ||
611 | "load_status": "Invalid header row: ", | 611 | "load_status": "Invalid header row: ", | ||
612 | "metadata_modified": "2021-11-23T21:47:42.044031", | 612 | "metadata_modified": "2021-11-23T21:47:42.044031", | ||
613 | "mimetype": "application/pdf", | 613 | "mimetype": "application/pdf", | ||
614 | "mimetype_inner": null, | 614 | "mimetype_inner": null, | ||
615 | "name": "Preliminary DNA Data Windermere Creek, BC Columbia | 615 | "name": "Preliminary DNA Data Windermere Creek, BC Columbia | ||
616 | Basin Water Quality Monitoring Project - Windermere Creek", | 616 | Basin Water Quality Monitoring Project - Windermere Creek", | ||
617 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 617 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
618 | "position": 11, | 618 | "position": 11, | ||
619 | "resource_citation": "Lake Windermere Ambassadors (2019). | 619 | "resource_citation": "Lake Windermere Ambassadors (2019). | ||
620 | Preliminary DNA Data Windermere Creek, BC Columbia Basin Water Quality | 620 | Preliminary DNA Data Windermere Creek, BC Columbia Basin Water Quality | ||
621 | Monitoring Project - Windermere Creek. Prepared for WWF Canada, | 621 | Monitoring Project - Windermere Creek. Prepared for WWF Canada, | ||
622 | Environment and Climate Change Canada, Living Lakes Canada. Columbia | 622 | Environment and Climate Change Canada, Living Lakes Canada. Columbia | ||
623 | Basin Water Hub (Resource). Invermere. (DOI)", | 623 | Basin Water Hub (Resource). Invermere. (DOI)", | ||
624 | "resource_data_disclaimer": "No warranty or guarantee exists | 624 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
625 | that the information is accurate, complete, current, or suitable for | 625 | that the information is accurate, complete, current, or suitable for | ||
626 | any purpose. The individual user must confirm the accuracy of the data | 626 | any purpose. The individual user must confirm the accuracy of the data | ||
627 | and whether it will be appropriate for their purpose.", | 627 | and whether it will be appropriate for their purpose.", | ||
628 | "resource_location": "Windermere Creek", | 628 | "resource_location": "Windermere Creek", | ||
629 | "resource_type": null, | 629 | "resource_type": null, | ||
630 | "size": 408000, | 630 | "size": 408000, | ||
631 | "state": "active", | 631 | "state": "active", | ||
632 | "url": | 632 | "url": | ||
633 | ermere-ambassadors_report_preliminarydnadatawindermerecreek_2019.pdf", | 633 | ermere-ambassadors_report_preliminarydnadatawindermerecreek_2019.pdf", | ||
634 | "url_type": "upload", | 634 | "url_type": "upload", | ||
635 | "waterhub_certified": "Certified", | 635 | "waterhub_certified": "Certified", | ||
636 | "waterhub_grade": "Not Reviewed" | 636 | "waterhub_grade": "Not Reviewed" | ||
637 | }, | 637 | }, | ||
638 | { | 638 | { | ||
639 | "cache_last_updated": null, | 639 | "cache_last_updated": null, | ||
640 | "cache_url": null, | 640 | "cache_url": null, | ||
641 | "created": "2021-11-23T22:10:12.978806", | 641 | "created": "2021-11-23T22:10:12.978806", | ||
642 | "data_collection_info": "n/a", | 642 | "data_collection_info": "n/a", | ||
643 | "data_processing": "n/a", | 643 | "data_processing": "n/a", | ||
644 | "datastore_active": false, | 644 | "datastore_active": false, | ||
645 | "description": "No aquatic invasive plant species were detected | 645 | "description": "No aquatic invasive plant species were detected | ||
646 | during shoreline surveys. There was a notable lack of aquatic plants | 646 | during shoreline surveys. There was a notable lack of aquatic plants | ||
647 | detected at the following survey stations: Baltac Beach, End of Ruault | 647 | detected at the following survey stations: Baltac Beach, End of Ruault | ||
648 | Rd, and Unofficial boat launch near Bayshore Condos.\r\n\r\nNo aquatic | 648 | Rd, and Unofficial boat launch near Bayshore Condos.\r\n\r\nNo aquatic | ||
649 | invasive plant species were detected during offshore surveys. As with | 649 | invasive plant species were detected during offshore surveys. As with | ||
650 | previous years of survey effort, dense areas or beds of indigenous | 650 | previous years of survey effort, dense areas or beds of indigenous | ||
651 | aquatic plants were observed in specific locations such as Ruault Road | 651 | aquatic plants were observed in specific locations such as Ruault Road | ||
652 | and Althalmer/Pete\u2019s Marina (Figure 1). There were some survey | 652 | and Althalmer/Pete\u2019s Marina (Figure 1). There were some survey | ||
653 | stations that were essentially devoid of aquatic plant communities, | 653 | stations that were essentially devoid of aquatic plant communities, | ||
654 | such as Baltac Beach, Unofficial boat launch near Bayshore Condos, and | 654 | such as Baltac Beach, Unofficial boat launch near Bayshore Condos, and | ||
655 | Tretheway Docks.", | 655 | Tretheway Docks.", | ||
656 | "format": "PDF", | 656 | "format": "PDF", | ||
657 | "hash": "6a3f5d12b394b13926e9fbb7552b66fa", | 657 | "hash": "6a3f5d12b394b13926e9fbb7552b66fa", | ||
658 | "header_row": "", | 658 | "header_row": "", | ||
659 | "id": "141a882d-dcb3-4ff2-bd42-3ee3fb580f0e", | 659 | "id": "141a882d-dcb3-4ff2-bd42-3ee3fb580f0e", | ||
660 | "last_modified": "2021-11-23T22:10:12.915634", | 660 | "last_modified": "2021-11-23T22:10:12.915634", | ||
661 | "metadata_modified": "2021-11-23T22:10:12.978806", | 661 | "metadata_modified": "2021-11-23T22:10:12.978806", | ||
662 | "mimetype": "application/pdf", | 662 | "mimetype": "application/pdf", | ||
663 | "mimetype_inner": null, | 663 | "mimetype_inner": null, | ||
664 | "name": "Aquatic Invasive Plant Species Inventory 2019", | 664 | "name": "Aquatic Invasive Plant Species Inventory 2019", | ||
665 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 665 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
666 | "position": 12, | 666 | "position": 12, | ||
667 | "resource_citation": "Darvill (2019). Lake Windermere Aquatic | 667 | "resource_citation": "Darvill (2019). Lake Windermere Aquatic | ||
668 | Invasive Plant Species Inventory 2019. Prepared for Lake Windermere | 668 | Invasive Plant Species Inventory 2019. Prepared for Lake Windermere | ||
669 | Ambassadors. Columbia Basin Water Hub (Resource).\u00a0Parson. (DOI)", | 669 | Ambassadors. Columbia Basin Water Hub (Resource).\u00a0Parson. (DOI)", | ||
670 | "resource_data_disclaimer": "No warranty or guarantee exists | 670 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
671 | that the information is accurate, complete, current, or suitable for | 671 | that the information is accurate, complete, current, or suitable for | ||
672 | any purpose. The individual user must confirm the accuracy of the data | 672 | any purpose. The individual user must confirm the accuracy of the data | ||
673 | and whether it will be appropriate for their purpose.", | 673 | and whether it will be appropriate for their purpose.", | ||
674 | "resource_location": "Lake Windermere", | 674 | "resource_location": "Lake Windermere", | ||
675 | "resource_type": null, | 675 | "resource_type": null, | ||
676 | "size": 1454992, | 676 | "size": 1454992, | ||
677 | "state": "active", | 677 | "state": "active", | ||
678 | "url": | 678 | "url": | ||
679 | _report_lakewindermereaquaticinvasiveplantspecies-inventory_2019.pdf", | 679 | _report_lakewindermereaquaticinvasiveplantspecies-inventory_2019.pdf", | ||
680 | "url_type": "upload", | 680 | "url_type": "upload", | ||
681 | "waterhub_certified": "Certified", | 681 | "waterhub_certified": "Certified", | ||
682 | "waterhub_grade": "People and Perspectives" | 682 | "waterhub_grade": "People and Perspectives" | ||
683 | }, | 683 | }, | ||
684 | { | 684 | { | ||
685 | "cache_last_updated": null, | 685 | "cache_last_updated": null, | ||
686 | "cache_url": null, | 686 | "cache_url": null, | ||
687 | "created": "2021-11-23T22:31:35.205581", | 687 | "created": "2021-11-23T22:31:35.205581", | ||
688 | "data_collection_info": "n/a", | 688 | "data_collection_info": "n/a", | ||
689 | "data_processing": "n/a", | 689 | "data_processing": "n/a", | ||
690 | "datastore_active": false, | 690 | "datastore_active": false, | ||
691 | "description": "No aquatic invasive plant species were detected | 691 | "description": "No aquatic invasive plant species were detected | ||
692 | during shoreline surveys. Aquatic invasive plant species detection is | 692 | during shoreline surveys. Aquatic invasive plant species detection is | ||
693 | the primary focus on this study. However, all native plant species | 693 | the primary focus on this study. However, all native plant species | ||
694 | that were collected through rake pulls are listed in Appendix 1. | 694 | that were collected through rake pulls are listed in Appendix 1. | ||
695 | \r\n\r\nAll offshore sampling resulted in no aquatic invasive plant | 695 | \r\n\r\nAll offshore sampling resulted in no aquatic invasive plant | ||
696 | species being detected. As with previous years of survey effort, dense | 696 | species being detected. As with previous years of survey effort, dense | ||
697 | areas of native aquatic plants were observed in locations such as | 697 | areas of native aquatic plants were observed in locations such as | ||
698 | Ruault Road and Althalmer/Pete\u2019s Marina. While aquatic invasive | 698 | Ruault Road and Althalmer/Pete\u2019s Marina. While aquatic invasive | ||
699 | plant detection was the primary focus of this study, all native | 699 | plant detection was the primary focus of this study, all native | ||
700 | aquatic plants were identified to the species level where possible, | 700 | aquatic plants were identified to the species level where possible, | ||
701 | and are listed in Appendix 2.", | 701 | and are listed in Appendix 2.", | ||
702 | "format": "PDF", | 702 | "format": "PDF", | ||
703 | "hash": "97d2fed2747971fb1bd9e1bc07637600", | 703 | "hash": "97d2fed2747971fb1bd9e1bc07637600", | ||
704 | "header_row": "", | 704 | "header_row": "", | ||
705 | "id": "bff727d2-e463-4a01-9c21-768180cbb0f5", | 705 | "id": "bff727d2-e463-4a01-9c21-768180cbb0f5", | ||
706 | "last_modified": "2021-11-23T22:31:35.136576", | 706 | "last_modified": "2021-11-23T22:31:35.136576", | ||
707 | "metadata_modified": "2021-11-23T22:31:35.205581", | 707 | "metadata_modified": "2021-11-23T22:31:35.205581", | ||
708 | "mimetype": "application/pdf", | 708 | "mimetype": "application/pdf", | ||
709 | "mimetype_inner": null, | 709 | "mimetype_inner": null, | ||
710 | "name": "Aquatic Invasive Plant Species Inventory 2018", | 710 | "name": "Aquatic Invasive Plant Species Inventory 2018", | ||
711 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 711 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
712 | "position": 13, | 712 | "position": 13, | ||
713 | "resource_citation": "Darvill (2018). Lake Windermere Aquatic | 713 | "resource_citation": "Darvill (2018). Lake Windermere Aquatic | ||
714 | Invasive Plant Species Inventory 2018. Prepared for Lake Windermere | 714 | Invasive Plant Species Inventory 2018. Prepared for Lake Windermere | ||
715 | Ambassadors. Columbia Basin Water Hub (Resource).\u00a0 Parson. | 715 | Ambassadors. Columbia Basin Water Hub (Resource).\u00a0 Parson. | ||
716 | (DOI)", | 716 | (DOI)", | ||
717 | "resource_data_disclaimer": "No warranty or guarantee exists | 717 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
718 | that the information is accurate, complete, current, or suitable for | 718 | that the information is accurate, complete, current, or suitable for | ||
719 | any purpose. The individual user must confirm the accuracy of the data | 719 | any purpose. The individual user must confirm the accuracy of the data | ||
720 | and whether it will be appropriate for their purpose.", | 720 | and whether it will be appropriate for their purpose.", | ||
721 | "resource_location": "Lake Windermere", | 721 | "resource_location": "Lake Windermere", | ||
722 | "resource_type": null, | 722 | "resource_type": null, | ||
723 | "size": 1354021, | 723 | "size": 1354021, | ||
724 | "state": "active", | 724 | "state": "active", | ||
725 | "url": | 725 | "url": | ||
726 | darvill_report_lakewindermereaquaticinvasiveplantsinventory_2018.pdf", | 726 | darvill_report_lakewindermereaquaticinvasiveplantsinventory_2018.pdf", | ||
727 | "url_type": "upload", | 727 | "url_type": "upload", | ||
728 | "waterhub_certified": "Certified", | 728 | "waterhub_certified": "Certified", | ||
729 | "waterhub_grade": "People and Perspectives" | 729 | "waterhub_grade": "People and Perspectives" | ||
730 | }, | 730 | }, | ||
731 | { | 731 | { | ||
732 | "cache_last_updated": null, | 732 | "cache_last_updated": null, | ||
733 | "cache_url": null, | 733 | "cache_url": null, | ||
734 | "created": "2021-11-23T22:44:38.629271", | 734 | "created": "2021-11-23T22:44:38.629271", | ||
735 | "data_collection_info": "n/a", | 735 | "data_collection_info": "n/a", | ||
736 | "data_processing": "n/a", | 736 | "data_processing": "n/a", | ||
737 | "datastore_active": false, | 737 | "datastore_active": false, | ||
738 | "description": "No aquatic invasive plant species were detected | 738 | "description": "No aquatic invasive plant species were detected | ||
739 | during the shoreline surveys. Aquatic invasive plant species detection | 739 | during the shoreline surveys. Aquatic invasive plant species detection | ||
740 | is the primary focus on this study; however, all native plant species | 740 | is the primary focus on this study; however, all native plant species | ||
741 | that were collected through rake pulls are listed in Appendix 1. | 741 | that were collected through rake pulls are listed in Appendix 1. | ||
742 | \r\n\r\nAll offshore sampling resulted in the detection of no aquatic | 742 | \r\n\r\nAll offshore sampling resulted in the detection of no aquatic | ||
743 | invasive plant species. Multiple beds of dense native aquatic plants | 743 | invasive plant species. Multiple beds of dense native aquatic plants | ||
744 | were located in locations such as Ruault Road and | 744 | were located in locations such as Ruault Road and | ||
745 | Althalmer/Pete\u2019s Marina. While aquatic invasive plant detection | 745 | Althalmer/Pete\u2019s Marina. While aquatic invasive plant detection | ||
746 | was the primary focus of this study, all native aquatic plants were | 746 | was the primary focus of this study, all native aquatic plants were | ||
747 | identified to the species level where possible, and are listed in | 747 | identified to the species level where possible, and are listed in | ||
748 | Appendix 2.\r\n\r\nAll veliger samples submitted by the EKISP to the | 748 | Appendix 2.\r\n\r\nAll veliger samples submitted by the EKISP to the | ||
749 | appropriate laboratory were reported back to the EKISC as negative. | 749 | appropriate laboratory were reported back to the EKISC as negative. | ||
750 | This indicates that no invasive mussel (Zebra Mussel (Dreissena | 750 | This indicates that no invasive mussel (Zebra Mussel (Dreissena | ||
751 | polymorph)/Quagga Mussel (Dreissena bugensis) veligers were identified | 751 | polymorph)/Quagga Mussel (Dreissena bugensis) veligers were identified | ||
752 | by the laboratory that analyzed the samples.", | 752 | by the laboratory that analyzed the samples.", | ||
753 | "format": "PDF", | 753 | "format": "PDF", | ||
754 | "hash": "2cc5a8ceb551df27d99f5f9718a11f46", | 754 | "hash": "2cc5a8ceb551df27d99f5f9718a11f46", | ||
755 | "header_row": "", | 755 | "header_row": "", | ||
756 | "id": "8cebdc8d-85ed-4c17-941e-3c50e4d84cd4", | 756 | "id": "8cebdc8d-85ed-4c17-941e-3c50e4d84cd4", | ||
757 | "last_modified": "2021-11-23T22:44:38.559073", | 757 | "last_modified": "2021-11-23T22:44:38.559073", | ||
758 | "metadata_modified": "2021-11-23T22:44:38.629271", | 758 | "metadata_modified": "2021-11-23T22:44:38.629271", | ||
759 | "mimetype": "application/pdf", | 759 | "mimetype": "application/pdf", | ||
760 | "mimetype_inner": null, | 760 | "mimetype_inner": null, | ||
761 | "name": "Aquatic Invasive Species Inventory 2017", | 761 | "name": "Aquatic Invasive Species Inventory 2017", | ||
762 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 762 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
763 | "position": 14, | 763 | "position": 14, | ||
764 | "resource_citation": "Darvill (2017). Lake Windermere Aquatic | 764 | "resource_citation": "Darvill (2017). Lake Windermere Aquatic | ||
765 | Invasive Species Inventory 2017. Prepared for Lake Windermere | 765 | Invasive Species Inventory 2017. Prepared for Lake Windermere | ||
766 | Ambassadors. Columbia Basin Water Hub (Resource).\u00a0Parson. | 766 | Ambassadors. Columbia Basin Water Hub (Resource).\u00a0Parson. | ||
767 | (DOI)\u2028", | 767 | (DOI)\u2028", | ||
768 | "resource_data_disclaimer": "No warranty or guarantee exists | 768 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
769 | that the information is accurate, complete, current, or suitable for | 769 | that the information is accurate, complete, current, or suitable for | ||
770 | any purpose. The individual user must confirm the accuracy of the data | 770 | any purpose. The individual user must confirm the accuracy of the data | ||
771 | and whether it will be appropriate for their purpose.", | 771 | and whether it will be appropriate for their purpose.", | ||
772 | "resource_location": "Lake Windermere", | 772 | "resource_location": "Lake Windermere", | ||
773 | "resource_type": null, | 773 | "resource_type": null, | ||
774 | "size": 1501477, | 774 | "size": 1501477, | ||
775 | "state": "active", | 775 | "state": "active", | ||
776 | "url": | 776 | "url": | ||
777 | darvill_report_lakewindermereaquaticinvasiveplantsinventory_2017.pdf", | 777 | darvill_report_lakewindermereaquaticinvasiveplantsinventory_2017.pdf", | ||
778 | "url_type": "upload", | 778 | "url_type": "upload", | ||
779 | "waterhub_certified": "Certified", | 779 | "waterhub_certified": "Certified", | ||
780 | "waterhub_grade": "People and Perspectives" | 780 | "waterhub_grade": "People and Perspectives" | ||
781 | }, | 781 | }, | ||
782 | { | 782 | { | ||
783 | "cache_last_updated": null, | 783 | "cache_last_updated": null, | ||
784 | "cache_url": null, | 784 | "cache_url": null, | ||
785 | "created": "2021-11-23T22:57:01.513020", | 785 | "created": "2021-11-23T22:57:01.513020", | ||
786 | "data_collection_info": "n/a", | 786 | "data_collection_info": "n/a", | ||
787 | "data_processing": "n/a", | 787 | "data_processing": "n/a", | ||
788 | "datastore_active": false, | 788 | "datastore_active": false, | ||
789 | "description": "The purpose of conducting AIS monitoring on Lake | 789 | "description": "The purpose of conducting AIS monitoring on Lake | ||
790 | Windermere in 2016 is to sample both offshore and onshore locations | 790 | Windermere in 2016 is to sample both offshore and onshore locations | ||
791 | for AIS such as Eurasian Watermilfoil (Myriophyllum spicatum), | 791 | for AIS such as Eurasian Watermilfoil (Myriophyllum spicatum), | ||
792 | Curyleaf Pondweed (Potamogeton crispu), Zebra Mussel (Dreissena | 792 | Curyleaf Pondweed (Potamogeton crispu), Zebra Mussel (Dreissena | ||
793 | polymorph) and Quagga Mussel (Dreissena bugensis). Continuing to | 793 | polymorph) and Quagga Mussel (Dreissena bugensis). Continuing to | ||
794 | sample for AIS on an annual basis on Lake Windermere will facilitate a | 794 | sample for AIS on an annual basis on Lake Windermere will facilitate a | ||
795 | rapid response for any detected species within this high risk lake | 795 | rapid response for any detected species within this high risk lake | ||
796 | ecosystem.", | 796 | ecosystem.", | ||
797 | "format": "PDF", | 797 | "format": "PDF", | ||
798 | "hash": "0e9235356278419204fd47722949065b", | 798 | "hash": "0e9235356278419204fd47722949065b", | ||
799 | "header_row": "", | 799 | "header_row": "", | ||
800 | "id": "cf49cf49-5e4a-494a-bb7f-5fd57fc88c02", | 800 | "id": "cf49cf49-5e4a-494a-bb7f-5fd57fc88c02", | ||
801 | "last_modified": "2021-11-23T22:57:01.438585", | 801 | "last_modified": "2021-11-23T22:57:01.438585", | ||
802 | "metadata_modified": "2021-11-23T22:57:01.513020", | 802 | "metadata_modified": "2021-11-23T22:57:01.513020", | ||
803 | "mimetype": "application/pdf", | 803 | "mimetype": "application/pdf", | ||
804 | "mimetype_inner": null, | 804 | "mimetype_inner": null, | ||
805 | "name": "Aquatic Invasive Species Sampling 2016", | 805 | "name": "Aquatic Invasive Species Sampling 2016", | ||
806 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 806 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
807 | "position": 15, | 807 | "position": 15, | ||
808 | "resource_citation": "Darvill (2016). Lake Windermere Aquatic | 808 | "resource_citation": "Darvill (2016). Lake Windermere Aquatic | ||
809 | Invasive Species Sampling 2016. Prepared for Lake Windermere | 809 | Invasive Species Sampling 2016. Prepared for Lake Windermere | ||
810 | Ambassadors. Columbia Basin Water Hub (Resource).\u00a0Parson. | 810 | Ambassadors. Columbia Basin Water Hub (Resource).\u00a0Parson. | ||
811 | (DOI)\u2028", | 811 | (DOI)\u2028", | ||
812 | "resource_data_disclaimer": "No warranty or guarantee exists | 812 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
813 | that the information is accurate, complete, current, or suitable for | 813 | that the information is accurate, complete, current, or suitable for | ||
814 | any purpose. The individual user must confirm the accuracy of the data | 814 | any purpose. The individual user must confirm the accuracy of the data | ||
815 | and whether it will be appropriate for their purpose.", | 815 | and whether it will be appropriate for their purpose.", | ||
816 | "resource_location": "Lake Windermere", | 816 | "resource_location": "Lake Windermere", | ||
817 | "resource_type": null, | 817 | "resource_type": null, | ||
818 | "size": 1528687, | 818 | "size": 1528687, | ||
819 | "state": "active", | 819 | "state": "active", | ||
820 | "url": | 820 | "url": | ||
821 | darvill_report_lakewindermereaquaticinvasiveplantsinventory_2016.pdf", | 821 | darvill_report_lakewindermereaquaticinvasiveplantsinventory_2016.pdf", | ||
822 | "url_type": "upload", | 822 | "url_type": "upload", | ||
823 | "waterhub_certified": "Certified", | 823 | "waterhub_certified": "Certified", | ||
824 | "waterhub_grade": "People and Perspectives" | 824 | "waterhub_grade": "People and Perspectives" | ||
825 | }, | 825 | }, | ||
826 | { | 826 | { | ||
827 | "cache_last_updated": null, | 827 | "cache_last_updated": null, | ||
828 | "cache_url": null, | 828 | "cache_url": null, | ||
829 | "created": "2021-11-23T23:10:09.741094", | 829 | "created": "2021-11-23T23:10:09.741094", | ||
830 | "data_collection_info": "n/a", | 830 | "data_collection_info": "n/a", | ||
831 | "data_processing": "n/a", | 831 | "data_processing": "n/a", | ||
832 | "datastore_active": false, | 832 | "datastore_active": false, | ||
833 | "description": "This year (2015) marked the sixth successive | 833 | "description": "This year (2015) marked the sixth successive | ||
834 | year (with the exception of 2013) where aquatic plants were sampled | 834 | year (with the exception of 2013) where aquatic plants were sampled | ||
835 | along multiple locations along the Lake Windermere shoreline. This | 835 | along multiple locations along the Lake Windermere shoreline. This | ||
836 | year also saw the first year of AIS sampling from a boat at offshore | 836 | year also saw the first year of AIS sampling from a boat at offshore | ||
837 | locations, including veliger sampling for invasive mussels (quagga and | 837 | locations, including veliger sampling for invasive mussels (quagga and | ||
838 | zebra).", | 838 | zebra).", | ||
839 | "format": "PDF", | 839 | "format": "PDF", | ||
840 | "hash": "c905077c6c7766a76ded7f930dc0f8ee", | 840 | "hash": "c905077c6c7766a76ded7f930dc0f8ee", | ||
841 | "header_row": "", | 841 | "header_row": "", | ||
842 | "id": "c52fe1c4-6791-4ac0-b1b8-5aa8123829f2", | 842 | "id": "c52fe1c4-6791-4ac0-b1b8-5aa8123829f2", | ||
843 | "last_modified": "2021-11-23T23:10:09.658955", | 843 | "last_modified": "2021-11-23T23:10:09.658955", | ||
844 | "metadata_modified": "2021-11-23T23:10:09.741094", | 844 | "metadata_modified": "2021-11-23T23:10:09.741094", | ||
845 | "mimetype": "application/pdf", | 845 | "mimetype": "application/pdf", | ||
846 | "mimetype_inner": null, | 846 | "mimetype_inner": null, | ||
847 | "name": "Aquatic Invasive Plant Sampling 2015", | 847 | "name": "Aquatic Invasive Plant Sampling 2015", | ||
848 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 848 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
849 | "position": 16, | 849 | "position": 16, | ||
850 | "resource_citation": "Darvill (2015). Lake Windermere Aquatic | 850 | "resource_citation": "Darvill (2015). Lake Windermere Aquatic | ||
851 | Invasive Plant Sampling 2015. Prepared for Lake Windermere | 851 | Invasive Plant Sampling 2015. Prepared for Lake Windermere | ||
852 | Ambassadors. Columbia Basin Water Hub (Resource).\u00a0Parson. | 852 | Ambassadors. Columbia Basin Water Hub (Resource).\u00a0Parson. | ||
853 | (DOI)\u2028", | 853 | (DOI)\u2028", | ||
854 | "resource_data_disclaimer": "No warranty or guarantee exists | 854 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
855 | that the information is accurate, complete, current, or suitable for | 855 | that the information is accurate, complete, current, or suitable for | ||
856 | any purpose. The individual user must confirm the accuracy of the data | 856 | any purpose. The individual user must confirm the accuracy of the data | ||
857 | and whether it will be appropriate for their purpose.", | 857 | and whether it will be appropriate for their purpose.", | ||
858 | "resource_location": "Lake Windermere", | 858 | "resource_location": "Lake Windermere", | ||
859 | "resource_type": null, | 859 | "resource_type": null, | ||
860 | "size": 894650, | 860 | "size": 894650, | ||
861 | "state": "active", | 861 | "state": "active", | ||
862 | "url": | 862 | "url": | ||
863 | darvill_report_lakewindermereaquaticinvasiveplantsinventory_2015.pdf", | 863 | darvill_report_lakewindermereaquaticinvasiveplantsinventory_2015.pdf", | ||
864 | "url_type": "upload", | 864 | "url_type": "upload", | ||
865 | "waterhub_certified": "Certified", | 865 | "waterhub_certified": "Certified", | ||
866 | "waterhub_grade": "People and Perspectives" | 866 | "waterhub_grade": "People and Perspectives" | ||
867 | }, | 867 | }, | ||
868 | { | 868 | { | ||
869 | "cache_last_updated": null, | 869 | "cache_last_updated": null, | ||
870 | "cache_url": null, | 870 | "cache_url": null, | ||
871 | "created": "2021-11-23T22:17:28.963537", | 871 | "created": "2021-11-23T22:17:28.963537", | ||
872 | "data_collection_info": "n/a", | 872 | "data_collection_info": "n/a", | ||
873 | "data_processing": "n/a", | 873 | "data_processing": "n/a", | ||
874 | "datastore_active": false, | 874 | "datastore_active": false, | ||
875 | "description": "The main purpose of this paper is to provide | 875 | "description": "The main purpose of this paper is to provide | ||
876 | information for what is currently known about the waterbird species | 876 | information for what is currently known about the waterbird species | ||
877 | that utilize Lake Windermere habitat. This report will provide the | 877 | that utilize Lake Windermere habitat. This report will provide the | ||
878 | findings of a single-day bird count conducted on the northern half of | 878 | findings of a single-day bird count conducted on the northern half of | ||
879 | Lake Windermere in September 2018. Lake Windermere bird data retrieved | 879 | Lake Windermere in September 2018. Lake Windermere bird data retrieved | ||
880 | from an online database (eBird) was reviewed and indicates that 165 | 880 | from an online database (eBird) was reviewed and indicates that 165 | ||
881 | bird species have been detected at Lake Windermere, 17 of these | 881 | bird species have been detected at Lake Windermere, 17 of these | ||
882 | species are considered to be at-risk. A review of historic and more | 882 | species are considered to be at-risk. A review of historic and more | ||
883 | recent bird data indicates that Lake Windermere contains important | 883 | recent bird data indicates that Lake Windermere contains important | ||
884 | bird habitat. The south end of the lake consistently has large | 884 | bird habitat. The south end of the lake consistently has large | ||
885 | concentrations of staging waterfowl during migration, and has the | 885 | concentrations of staging waterfowl during migration, and has the | ||
886 | highest single day bird counts resulting from a regional coordinated | 886 | highest single day bird counts resulting from a regional coordinated | ||
887 | bird count (i.e. Columbia Wetlands Waterbird Survey). When compared | 887 | bird count (i.e. Columbia Wetlands Waterbird Survey). When compared | ||
888 | across 105 survey stations in the Columbia Wetlands, the south end of | 888 | across 105 survey stations in the Columbia Wetlands, the south end of | ||
889 | Lake Windermere appears to contain the most important staging area | 889 | Lake Windermere appears to contain the most important staging area | ||
890 | within the continuous wetlands ecosystem for at-risk grebe species, as | 890 | within the continuous wetlands ecosystem for at-risk grebe species, as | ||
891 | well as for other bird species such as American coot. Creek mouths | 891 | well as for other bird species such as American coot. Creek mouths | ||
892 | found at Lake Windermere are also important habitat for birds, | 892 | found at Lake Windermere are also important habitat for birds, | ||
893 | especially for migrating shorebirds. Information on why birds are | 893 | especially for migrating shorebirds. Information on why birds are | ||
894 | important will be presented here, as well as a brief overview on the | 894 | important will be presented here, as well as a brief overview on the | ||
895 | decline of more than one-third of the world\u2019s bird populations. | 895 | decline of more than one-third of the world\u2019s bird populations. | ||
896 | Several suggestions for future action will be provided that may help | 896 | Several suggestions for future action will be provided that may help | ||
897 | to ensure that Lake Windermere continues to provide important habitat | 897 | to ensure that Lake Windermere continues to provide important habitat | ||
898 | to birds. These include: a) conducting additional fall bird surveys on | 898 | to birds. These include: a) conducting additional fall bird surveys on | ||
899 | the lake, b) completing spring breeding bird surveys in order to | 899 | the lake, b) completing spring breeding bird surveys in order to | ||
900 | assess the utilization of the lake area during a critical life history | 900 | assess the utilization of the lake area during a critical life history | ||
901 | stage and to identify and conserve key breeding sites, c) minimizing | 901 | stage and to identify and conserve key breeding sites, c) minimizing | ||
902 | boat traffic in and near nesting, staging, feeding areas during | 902 | boat traffic in and near nesting, staging, feeding areas during | ||
903 | specific times of year, d) public education regarding the importance | 903 | specific times of year, d) public education regarding the importance | ||
904 | of Lake Windermere to birds including at-risk species, and e) marking | 904 | of Lake Windermere to birds including at-risk species, and e) marking | ||
905 | the wildlife management area located at the south end of Lake | 905 | the wildlife management area located at the south end of Lake | ||
906 | Windermere with educational buoys alerting all recreational users of | 906 | Windermere with educational buoys alerting all recreational users of | ||
907 | this boundary (i.e. current legal restrictions make this area | 907 | this boundary (i.e. current legal restrictions make this area | ||
908 | off-limits to motorized water craft). Currently, there are fewer | 908 | off-limits to motorized water craft). Currently, there are fewer | ||
909 | significant wetland areas in the world remaining as habitat for birds. | 909 | significant wetland areas in the world remaining as habitat for birds. | ||
910 | These remaining key areas deserve conservation attention and | 910 | These remaining key areas deserve conservation attention and | ||
911 | recognition.", | 911 | recognition.", | ||
912 | "format": "PDF", | 912 | "format": "PDF", | ||
913 | "hash": "bf1420857dd34dceb70ac95a7802df06", | 913 | "hash": "bf1420857dd34dceb70ac95a7802df06", | ||
914 | "header_row": "", | 914 | "header_row": "", | ||
915 | "id": "6871538d-ae61-46cb-b7bb-0c7d8e2a2bc1", | 915 | "id": "6871538d-ae61-46cb-b7bb-0c7d8e2a2bc1", | ||
916 | "last_modified": "2021-11-23T22:17:28.898335", | 916 | "last_modified": "2021-11-23T22:17:28.898335", | ||
917 | "metadata_modified": "2021-11-23T22:17:28.963537", | 917 | "metadata_modified": "2021-11-23T22:17:28.963537", | ||
918 | "mimetype": "application/pdf", | 918 | "mimetype": "application/pdf", | ||
919 | "mimetype_inner": null, | 919 | "mimetype_inner": null, | ||
920 | "name": "Insight into the Waterbirds of Lake Windermere", | 920 | "name": "Insight into the Waterbirds of Lake Windermere", | ||
921 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 921 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
922 | "position": 17, | 922 | "position": 17, | ||
923 | "resource_citation": "Darvill (2019). Insight into the | 923 | "resource_citation": "Darvill (2019). Insight into the | ||
924 | Waterbirds of Lake Windermere. Prepared for Lake Windermere | 924 | Waterbirds of Lake Windermere. Prepared for Lake Windermere | ||
925 | Ambassadors. Columbia Basin Water Hub (Resource).\u00a0 Parson. | 925 | Ambassadors. Columbia Basin Water Hub (Resource).\u00a0 Parson. | ||
926 | (DOI)", | 926 | (DOI)", | ||
927 | "resource_data_disclaimer": "No warranty or guarantee exists | 927 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
928 | that the information is accurate, complete, current, or suitable for | 928 | that the information is accurate, complete, current, or suitable for | ||
929 | any purpose. The individual user must confirm the accuracy of the data | 929 | any purpose. The individual user must confirm the accuracy of the data | ||
930 | and whether it will be appropriate for their purpose.", | 930 | and whether it will be appropriate for their purpose.", | ||
931 | "resource_location": "Lake Windermere", | 931 | "resource_location": "Lake Windermere", | ||
932 | "resource_type": null, | 932 | "resource_type": null, | ||
933 | "size": 2009958, | 933 | "size": 2009958, | ||
934 | "state": "active", | 934 | "state": "active", | ||
935 | "url": | 935 | "url": | ||
936 | lwa_darvill_report_insightintothewaterbirdsoflakewindermere_2019.pdf", | 936 | lwa_darvill_report_insightintothewaterbirdsoflakewindermere_2019.pdf", | ||
937 | "url_type": "upload", | 937 | "url_type": "upload", | ||
938 | "waterhub_certified": "Certified", | 938 | "waterhub_certified": "Certified", | ||
939 | "waterhub_grade": "People and Perspectives" | 939 | "waterhub_grade": "People and Perspectives" | ||
940 | } | 940 | } | ||
941 | ], | 941 | ], | ||
942 | "start_date": "2009-01-01", | 942 | "start_date": "2009-01-01", | ||
943 | "state": "active", | 943 | "state": "active", | ||
944 | "tags": [ | 944 | "tags": [ | ||
945 | { | 945 | { | ||
946 | "display_name": "Bacteriological", | 946 | "display_name": "Bacteriological", | ||
947 | "id": "b446598e-8ac4-4dce-8eed-3ab2d595aca7", | 947 | "id": "b446598e-8ac4-4dce-8eed-3ab2d595aca7", | ||
948 | "name": "Bacteriological", | 948 | "name": "Bacteriological", | ||
949 | "state": "active", | 949 | "state": "active", | ||
950 | "vocabulary_id": null | 950 | "vocabulary_id": null | ||
951 | }, | 951 | }, | ||
952 | { | 952 | { | ||
953 | "display_name": "CABIN", | 953 | "display_name": "CABIN", | ||
954 | "id": "476e5cf2-3801-40e8-9c73-dac2cedbaf7f", | 954 | "id": "476e5cf2-3801-40e8-9c73-dac2cedbaf7f", | ||
955 | "name": "CABIN", | 955 | "name": "CABIN", | ||
956 | "state": "active", | 956 | "state": "active", | ||
957 | "vocabulary_id": null | 957 | "vocabulary_id": null | ||
958 | }, | 958 | }, | ||
959 | { | 959 | { | ||
960 | "display_name": "Community-based monitoring", | 960 | "display_name": "Community-based monitoring", | ||
961 | "id": "9b75240a-5e54-43c9-9063-969983d065f6", | 961 | "id": "9b75240a-5e54-43c9-9063-969983d065f6", | ||
962 | "name": "Community-based monitoring", | 962 | "name": "Community-based monitoring", | ||
963 | "state": "active", | 963 | "state": "active", | ||
964 | "vocabulary_id": null | 964 | "vocabulary_id": null | ||
965 | }, | 965 | }, | ||
966 | { | 966 | { | ||
967 | "display_name": "Fish", | 967 | "display_name": "Fish", | ||
968 | "id": "e5dce2fc-ec9c-4a16-83b3-9b1d0f991c12", | 968 | "id": "e5dce2fc-ec9c-4a16-83b3-9b1d0f991c12", | ||
969 | "name": "Fish", | 969 | "name": "Fish", | ||
970 | "state": "active", | 970 | "state": "active", | ||
971 | "vocabulary_id": null | 971 | "vocabulary_id": null | ||
972 | }, | 972 | }, | ||
973 | { | 973 | { | ||
974 | "display_name": "Hydrology", | 974 | "display_name": "Hydrology", | ||
975 | "id": "eb52bf78-f171-4c0b-961b-c7a49fed2236", | 975 | "id": "eb52bf78-f171-4c0b-961b-c7a49fed2236", | ||
976 | "name": "Hydrology", | 976 | "name": "Hydrology", | ||
977 | "state": "active", | 977 | "state": "active", | ||
978 | "vocabulary_id": null | 978 | "vocabulary_id": null | ||
979 | }, | 979 | }, | ||
980 | { | 980 | { | ||
981 | "display_name": "Hydrometric", | 981 | "display_name": "Hydrometric", | ||
982 | "id": "ae588e2d-8628-4e7f-ad0a-2cbd38adfd76", | 982 | "id": "ae588e2d-8628-4e7f-ad0a-2cbd38adfd76", | ||
983 | "name": "Hydrometric", | 983 | "name": "Hydrometric", | ||
984 | "state": "active", | 984 | "state": "active", | ||
985 | "vocabulary_id": null | 985 | "vocabulary_id": null | ||
986 | }, | 986 | }, | ||
987 | { | 987 | { | ||
988 | "display_name": "Lake", | 988 | "display_name": "Lake", | ||
989 | "id": "66dc1292-41ac-45cf-a267-f0d5c8a31826", | 989 | "id": "66dc1292-41ac-45cf-a267-f0d5c8a31826", | ||
990 | "name": "Lake", | 990 | "name": "Lake", | ||
991 | "state": "active", | 991 | "state": "active", | ||
992 | "vocabulary_id": null | 992 | "vocabulary_id": null | ||
993 | }, | 993 | }, | ||
994 | { | 994 | { | ||
995 | "display_name": "People and Perspectives", | 995 | "display_name": "People and Perspectives", | ||
996 | "id": "bce02f6f-d09f-4305-8e4e-bfeabaeb3a2c", | 996 | "id": "bce02f6f-d09f-4305-8e4e-bfeabaeb3a2c", | ||
997 | "name": "People and Perspectives", | 997 | "name": "People and Perspectives", | ||
998 | "state": "active", | 998 | "state": "active", | ||
999 | "vocabulary_id": null | 999 | "vocabulary_id": null | ||
1000 | }, | 1000 | }, | ||
1001 | { | 1001 | { | ||
1002 | "display_name": "Sediment Analysis", | 1002 | "display_name": "Sediment Analysis", | ||
1003 | "id": "7bb5f9ef-401c-4112-8a32-4a31695a3e25", | 1003 | "id": "7bb5f9ef-401c-4112-8a32-4a31695a3e25", | ||
1004 | "name": "Sediment Analysis", | 1004 | "name": "Sediment Analysis", | ||
1005 | "state": "active", | 1005 | "state": "active", | ||
1006 | "vocabulary_id": null | 1006 | "vocabulary_id": null | ||
1007 | }, | 1007 | }, | ||
1008 | { | 1008 | { | ||
1009 | "display_name": "Stream", | 1009 | "display_name": "Stream", | ||
1010 | "id": "208421f0-ebb5-4b32-8111-2ff156803d73", | 1010 | "id": "208421f0-ebb5-4b32-8111-2ff156803d73", | ||
1011 | "name": "Stream", | 1011 | "name": "Stream", | ||
1012 | "state": "active", | 1012 | "state": "active", | ||
1013 | "vocabulary_id": null | 1013 | "vocabulary_id": null | ||
1014 | }, | 1014 | }, | ||
1015 | { | 1015 | { | ||
1016 | "display_name": "Water Quality", | 1016 | "display_name": "Water Quality", | ||
1017 | "id": "12fe3ab5-fdaf-44c5-8167-06c7589d90f3", | 1017 | "id": "12fe3ab5-fdaf-44c5-8167-06c7589d90f3", | ||
1018 | "name": "Water Quality", | 1018 | "name": "Water Quality", | ||
1019 | "state": "active", | 1019 | "state": "active", | ||
1020 | "vocabulary_id": null | 1020 | "vocabulary_id": null | ||
1021 | }, | 1021 | }, | ||
1022 | { | 1022 | { | ||
1023 | "display_name": "Water temperature", | 1023 | "display_name": "Water temperature", | ||
1024 | "id": "0770347d-73eb-4f60-a661-50199f7049c3", | 1024 | "id": "0770347d-73eb-4f60-a661-50199f7049c3", | ||
1025 | "name": "Water temperature", | 1025 | "name": "Water temperature", | ||
1026 | "state": "active", | 1026 | "state": "active", | ||
1027 | "vocabulary_id": null | 1027 | "vocabulary_id": null | ||
1028 | } | 1028 | } | ||
1029 | ], | 1029 | ], | ||
1030 | "title": "Lake Windermere Ambassadors Annual Water Monitoring | 1030 | "title": "Lake Windermere Ambassadors Annual Water Monitoring | ||
1031 | Reports", | 1031 | Reports", | ||
1032 | "type": "dataset", | 1032 | "type": "dataset", | ||
1033 | "url": null, | 1033 | "url": null, | ||
1034 | "version": null | 1034 | "version": null | ||
1035 | } | 1035 | } |