Changes
On May 12, 2022 at 3:16:06 PM UTC, verenashaw-6471:
-
Added the following fields to resource Aquatic Invasive Plant Species Inventory 2018 in Lake Windermere Ambassadors Annual Water Monitoring Reports
-
datastore_status with value
load_status with value
-
Changed value of field
resource_citation
of resource Aquatic Invasive Plant Species Inventory 2018 toDarvill. (2018). Lake Windermere Aquatic Invasive Plant Species Inventory 2018. Prepared for Lake Windermere Ambassadors. Columbia Basin Water Hub [Resource]. Parson. https://doi.org/10.48511/KBGB-DJ25
(previouslyDarvill (2018). Lake Windermere Aquatic Invasive Plant Species Inventory 2018. Prepared for Lake Windermere Ambassadors. Columbia Basin Water Hub (Resource). Parson. (DOI)
) in Lake Windermere Ambassadors Annual Water Monitoring Reports
f | 1 | { | f | 1 | { |
2 | "author": null, | 2 | "author": null, | ||
3 | "author_email": null, | 3 | "author_email": null, | ||
4 | "citation": "Lake Windermere Ambassadors. (2021). Lake Windermere | 4 | "citation": "Lake Windermere Ambassadors. (2021). Lake Windermere | ||
5 | Ambassadors Annual Water Monitoring Reports [Data set]. Columbia Basin | 5 | Ambassadors Annual Water Monitoring Reports [Data set]. Columbia Basin | ||
6 | Water Hub. https://doi.org/10.48511/KBGB-DJ25", | 6 | Water Hub. https://doi.org/10.48511/KBGB-DJ25", | ||
7 | "creator": "Lake Windermere Ambassadors", | 7 | "creator": "Lake Windermere Ambassadors", | ||
8 | "creator_user_id": "efbb05c2-ed3c-42ec-894b-cafbb9d5f2db", | 8 | "creator_user_id": "efbb05c2-ed3c-42ec-894b-cafbb9d5f2db", | ||
9 | "data_disclaimer": "No warranty or guarantee exists that the | 9 | "data_disclaimer": "No warranty or guarantee exists that the | ||
10 | information is accurate, complete, current, or suitable for any | 10 | information is accurate, complete, current, or suitable for any | ||
11 | purpose. The individual user must confirm the accuracy of the data and | 11 | purpose. The individual user must confirm the accuracy of the data and | ||
12 | whether it will be appropriate for their purpose.", | 12 | whether it will be appropriate for their purpose.", | ||
13 | "data_type": "Lake", | 13 | "data_type": "Lake", | ||
14 | "end_date": "2020-12-31", | 14 | "end_date": "2020-12-31", | ||
15 | "funding_reference": "See individual reporots for funding | 15 | "funding_reference": "See individual reporots for funding | ||
16 | description.", | 16 | description.", | ||
17 | "groups": [ | 17 | "groups": [ | ||
18 | { | 18 | { | ||
19 | "description": "This group includes all the datasets which fall | 19 | "description": "This group includes all the datasets which fall | ||
20 | within the Columbia-Kootenay Headwaters Hydrologic region ", | 20 | within the Columbia-Kootenay Headwaters Hydrologic region ", | ||
21 | "display_name": "Columbia-Kootenay Headwaters", | 21 | "display_name": "Columbia-Kootenay Headwaters", | ||
22 | "id": "20673d8f-8f40-4e64-9f34-4966d5123705", | 22 | "id": "20673d8f-8f40-4e64-9f34-4966d5123705", | ||
23 | "image_display_url": | 23 | "image_display_url": | ||
24 | rhub.ca/uploads/group/2021-03-02-214610.209659Mapfinalheadwayers.png", | 24 | rhub.ca/uploads/group/2021-03-02-214610.209659Mapfinalheadwayers.png", | ||
25 | "name": "columbia-kootenay-headwaters", | 25 | "name": "columbia-kootenay-headwaters", | ||
26 | "title": "Columbia-Kootenay Headwaters" | 26 | "title": "Columbia-Kootenay Headwaters" | ||
27 | } | 27 | } | ||
28 | ], | 28 | ], | ||
29 | "id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 29 | "id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
30 | "identifier": "10.48511/KBGB-DJ25", | 30 | "identifier": "10.48511/KBGB-DJ25", | ||
31 | "isopen": false, | 31 | "isopen": false, | ||
32 | "keywords": "Community-based | 32 | "keywords": "Community-based | ||
33 | monitoring,Hydrology,Hydrometric,Fish,Lake,People and | 33 | monitoring,Hydrology,Hydrometric,Fish,Lake,People and | ||
34 | Perspectives,Water Quality,Stream,Water temperature,Sediment | 34 | Perspectives,Water Quality,Stream,Water temperature,Sediment | ||
35 | Analysis,Bacteriological,CABIN", | 35 | Analysis,Bacteriological,CABIN", | ||
36 | "latitude": "50.472805", | 36 | "latitude": "50.472805", | ||
37 | "license_id": "CC-BY-SA-4.0", | 37 | "license_id": "CC-BY-SA-4.0", | ||
38 | "license_title": "CC-BY-SA-4.0", | 38 | "license_title": "CC-BY-SA-4.0", | ||
39 | "location": "Lake Windermere, Windermere Creek", | 39 | "location": "Lake Windermere, Windermere Creek", | ||
40 | "longitude": "-116.019217", | 40 | "longitude": "-116.019217", | ||
41 | "maintainer": null, | 41 | "maintainer": null, | ||
42 | "maintainer_email": "cbwaterhub@livinglakescanada.ca", | 42 | "maintainer_email": "cbwaterhub@livinglakescanada.ca", | ||
43 | "metadata_created": "2021-11-23T21:03:29.640876", | 43 | "metadata_created": "2021-11-23T21:03:29.640876", | ||
n | 44 | "metadata_modified": "2022-05-12T15:14:45.543070", | n | 44 | "metadata_modified": "2022-05-12T15:16:06.653430", |
45 | "name": | 45 | "name": | ||
46 | "lake-windermere-ambassadors-annual-water-monitoring-reports", | 46 | "lake-windermere-ambassadors-annual-water-monitoring-reports", | ||
47 | "notes": "Included are the annual water monitoring reports from Lake | 47 | "notes": "Included are the annual water monitoring reports from Lake | ||
48 | Windermere and Windermere Creek as well as aquatic invasive plant | 48 | Windermere and Windermere Creek as well as aquatic invasive plant | ||
49 | reports and a report on Lake Windermere water birds.", | 49 | reports and a report on Lake Windermere water birds.", | ||
50 | "num_resources": 18, | 50 | "num_resources": 18, | ||
51 | "num_tags": 12, | 51 | "num_tags": 12, | ||
52 | "organization": { | 52 | "organization": { | ||
53 | "approval_status": "approved", | 53 | "approval_status": "approved", | ||
54 | "created": "2021-05-20T09:58:43.376117", | 54 | "created": "2021-05-20T09:58:43.376117", | ||
55 | "description": "The Lake Windermere Ambassadors are a | 55 | "description": "The Lake Windermere Ambassadors are a | ||
56 | community-based environmental stewardship non-profit working in the | 56 | community-based environmental stewardship non-profit working in the | ||
57 | East Kootenay region of BC. The Ambassadors have a vision of an | 57 | East Kootenay region of BC. The Ambassadors have a vision of an | ||
58 | ecologically healthy Lake Windermere with balanced management | 58 | ecologically healthy Lake Windermere with balanced management | ||
59 | approaches that support recreation and traditional uses, high fish and | 59 | approaches that support recreation and traditional uses, high fish and | ||
60 | wildlife values, and economic prosperity in the region.", | 60 | wildlife values, and economic prosperity in the region.", | ||
61 | "id": "fa6d1422-26e0-4d81-9abc-94f8fb043e7c", | 61 | "id": "fa6d1422-26e0-4d81-9abc-94f8fb043e7c", | ||
62 | "image_url": "2021-05-20-174743.524491Master-Large.png", | 62 | "image_url": "2021-05-20-174743.524491Master-Large.png", | ||
63 | "is_organization": true, | 63 | "is_organization": true, | ||
64 | "name": "lake-windermere", | 64 | "name": "lake-windermere", | ||
65 | "state": "active", | 65 | "state": "active", | ||
66 | "title": "Lake Windermere Ambassadors", | 66 | "title": "Lake Windermere Ambassadors", | ||
67 | "type": "organization" | 67 | "type": "organization" | ||
68 | }, | 68 | }, | ||
69 | "other_sources": "n/a", | 69 | "other_sources": "n/a", | ||
70 | "owner_org": "fa6d1422-26e0-4d81-9abc-94f8fb043e7c", | 70 | "owner_org": "fa6d1422-26e0-4d81-9abc-94f8fb043e7c", | ||
71 | "private": false, | 71 | "private": false, | ||
72 | "publication_year": "2021", | 72 | "publication_year": "2021", | ||
73 | "relationships_as_object": [], | 73 | "relationships_as_object": [], | ||
74 | "relationships_as_subject": [], | 74 | "relationships_as_subject": [], | ||
75 | "resources": [ | 75 | "resources": [ | ||
76 | { | 76 | { | ||
77 | "cache_last_updated": null, | 77 | "cache_last_updated": null, | ||
78 | "cache_url": null, | 78 | "cache_url": null, | ||
79 | "created": "2021-11-23T21:14:26.266170", | 79 | "created": "2021-11-23T21:14:26.266170", | ||
80 | "data_collection_info": "N/A", | 80 | "data_collection_info": "N/A", | ||
81 | "data_processing": "N/A", | 81 | "data_processing": "N/A", | ||
82 | "datastore_active": false, | 82 | "datastore_active": false, | ||
83 | "datastore_status": "", | 83 | "datastore_status": "", | ||
84 | "description": "In 2020, the Lake Windermere Ambassadors | 84 | "description": "In 2020, the Lake Windermere Ambassadors | ||
85 | collected physical and chemical water quality parameters at three | 85 | collected physical and chemical water quality parameters at three | ||
86 | sample sites on Lake Windermere once weekly during the summer, from | 86 | sample sites on Lake Windermere once weekly during the summer, from | ||
87 | late May to September\u200b. The lake sampling regime included water | 87 | late May to September\u200b. The lake sampling regime included water | ||
88 | temperature, turbidity/clarity, pH, conductivity, depth, and dissolved | 88 | temperature, turbidity/clarity, pH, conductivity, depth, and dissolved | ||
89 | oxygen. Once monthly from May to September we collected Total | 89 | oxygen. Once monthly from May to September we collected Total | ||
90 | Dissolved Phosphorus and Total Phosphorous. The LWA monitored | 90 | Dissolved Phosphorus and Total Phosphorous. The LWA monitored | ||
91 | substrate samplers at six sites on the east side of Lake Windermere | 91 | substrate samplers at six sites on the east side of Lake Windermere | ||
92 | for invasive mussels, and monitored tributary flows and water quality | 92 | for invasive mussels, and monitored tributary flows and water quality | ||
93 | at the outlet of Windermere Creek and Abel Creek. \u200bE. coli data | 93 | at the outlet of Windermere Creek and Abel Creek. \u200bE. coli data | ||
94 | was collected at public swim beaches weekly, from May until September, | 94 | was collected at public swim beaches weekly, from May until September, | ||
95 | excluding weeks with a statutory holiday Monday, in partnership with | 95 | excluding weeks with a statutory holiday Monday, in partnership with | ||
96 | the Interior Health Authority.", | 96 | the Interior Health Authority.", | ||
97 | "format": "PDF", | 97 | "format": "PDF", | ||
98 | "hash": "e7a7c3e18b245292c6e847bb9235bbac", | 98 | "hash": "e7a7c3e18b245292c6e847bb9235bbac", | ||
99 | "header_row": "", | 99 | "header_row": "", | ||
100 | "id": "1e59877d-72a2-4fed-bd21-9d613c0e53a5", | 100 | "id": "1e59877d-72a2-4fed-bd21-9d613c0e53a5", | ||
101 | "last_modified": "2021-11-23T21:14:26.212715", | 101 | "last_modified": "2021-11-23T21:14:26.212715", | ||
102 | "load_status": "", | 102 | "load_status": "", | ||
103 | "metadata_modified": "2022-05-12T14:36:53.412360", | 103 | "metadata_modified": "2022-05-12T14:36:53.412360", | ||
104 | "mimetype": "application/pdf", | 104 | "mimetype": "application/pdf", | ||
105 | "mimetype_inner": null, | 105 | "mimetype_inner": null, | ||
106 | "name": "Water Quality Monitoring Program 2020 Final Report", | 106 | "name": "Water Quality Monitoring Program 2020 Final Report", | ||
107 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 107 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
108 | "position": 0, | 108 | "position": 0, | ||
109 | "resource_citation": "Peck, G. (2021). Lake Windermere Community | 109 | "resource_citation": "Peck, G. (2021). Lake Windermere Community | ||
110 | Based Water Quality Monitoring Program 2020 Final Report. Prepared for | 110 | Based Water Quality Monitoring Program 2020 Final Report. Prepared for | ||
111 | Lake Windermere Ambassadors. Columbia Basin Water Hub. [Resource]. | 111 | Lake Windermere Ambassadors. Columbia Basin Water Hub. [Resource]. | ||
112 | Invermere. https://doi.org/10.48511/KBGB-DJ25", | 112 | Invermere. https://doi.org/10.48511/KBGB-DJ25", | ||
113 | "resource_data_disclaimer": "No warranty or guarantee exists | 113 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
114 | that the information is accurate, complete, current, or suitable for | 114 | that the information is accurate, complete, current, or suitable for | ||
115 | any purpose. The individual user must confirm the accuracy of the data | 115 | any purpose. The individual user must confirm the accuracy of the data | ||
116 | and whether it will be appropriate for their purpose.", | 116 | and whether it will be appropriate for their purpose.", | ||
117 | "resource_location": "Lake Windermere", | 117 | "resource_location": "Lake Windermere", | ||
118 | "resource_type": null, | 118 | "resource_type": null, | ||
119 | "size": 1595807, | 119 | "size": 1595807, | ||
120 | "state": "active", | 120 | "state": "active", | ||
121 | "url": | 121 | "url": | ||
122 | d/lwa_peck_report_lkwindermerewaterqualitymonitoringprogram_2020.pdf", | 122 | d/lwa_peck_report_lkwindermerewaterqualitymonitoringprogram_2020.pdf", | ||
123 | "url_type": "upload", | 123 | "url_type": "upload", | ||
124 | "waterhub_certified": "Certified", | 124 | "waterhub_certified": "Certified", | ||
125 | "waterhub_grade": "People and Perspectives" | 125 | "waterhub_grade": "People and Perspectives" | ||
126 | }, | 126 | }, | ||
127 | { | 127 | { | ||
128 | "cache_last_updated": null, | 128 | "cache_last_updated": null, | ||
129 | "cache_url": null, | 129 | "cache_url": null, | ||
130 | "created": "2021-11-23T21:55:51.837852", | 130 | "created": "2021-11-23T21:55:51.837852", | ||
131 | "data_collection_info": "n/a", | 131 | "data_collection_info": "n/a", | ||
132 | "data_processing": "n/a", | 132 | "data_processing": "n/a", | ||
133 | "datastore_active": false, | 133 | "datastore_active": false, | ||
134 | "datastore_status": "", | 134 | "datastore_status": "", | ||
135 | "description": "In 2019, the Lake Windermere Ambassadors | 135 | "description": "In 2019, the Lake Windermere Ambassadors | ||
136 | collected physical and chemical water quality parameters at three | 136 | collected physical and chemical water quality parameters at three | ||
137 | sample sites on Lake Windermere once weekly during the summer, from | 137 | sample sites on Lake Windermere once weekly during the summer, from | ||
138 | late May to September. The lake sampling regime included water | 138 | late May to September. The lake sampling regime included water | ||
139 | temperature, turbidity/clarity, pH, conductivity, depth, and dissolved | 139 | temperature, turbidity/clarity, pH, conductivity, depth, and dissolved | ||
140 | oxygen. Once monthly from May to September we collected Total | 140 | oxygen. Once monthly from May to September we collected Total | ||
141 | Dissolved Phosphorus and Total Phosphorous. In addition, the LWA | 141 | Dissolved Phosphorus and Total Phosphorous. In addition, the LWA | ||
142 | monitored substrate samplers at six sites on the east side of Lake | 142 | monitored substrate samplers at six sites on the east side of Lake | ||
143 | Windermere for invasive mussels, as well as monitoring tributary flows | 143 | Windermere for invasive mussels, as well as monitoring tributary flows | ||
144 | and water quality at the outlet of Windermere Creek and Abel Creek. E. | 144 | and water quality at the outlet of Windermere Creek and Abel Creek. E. | ||
145 | coli data was collected at public swim beaches weekly, from May until | 145 | coli data was collected at public swim beaches weekly, from May until | ||
146 | September, excluding weeks with a statutory holiday Monday, in | 146 | September, excluding weeks with a statutory holiday Monday, in | ||
147 | partnership with the Interior Health Authority. Lastly, Goldeneye | 147 | partnership with the Interior Health Authority. Lastly, Goldeneye | ||
148 | Ecological Services was contracted to complete an aquatic plant | 148 | Ecological Services was contracted to complete an aquatic plant | ||
149 | survey, and fall waterbird survey on Lake Windermere.", | 149 | survey, and fall waterbird survey on Lake Windermere.", | ||
150 | "format": "PDF", | 150 | "format": "PDF", | ||
151 | "hash": "3d388a54d7dc9fef6df16bd80732492f", | 151 | "hash": "3d388a54d7dc9fef6df16bd80732492f", | ||
152 | "header_row": "", | 152 | "header_row": "", | ||
153 | "id": "d9db0064-520b-4e59-a537-4164219cb5bf", | 153 | "id": "d9db0064-520b-4e59-a537-4164219cb5bf", | ||
154 | "last_modified": "2021-11-23T21:55:51.776932", | 154 | "last_modified": "2021-11-23T21:55:51.776932", | ||
155 | "load_status": "", | 155 | "load_status": "", | ||
156 | "metadata_modified": "2022-05-12T14:56:21.447132", | 156 | "metadata_modified": "2022-05-12T14:56:21.447132", | ||
157 | "mimetype": "application/pdf", | 157 | "mimetype": "application/pdf", | ||
158 | "mimetype_inner": null, | 158 | "mimetype_inner": null, | ||
159 | "name": "Water Quality Monitoring Program 2019 Final Report", | 159 | "name": "Water Quality Monitoring Program 2019 Final Report", | ||
160 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 160 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
161 | "position": 1, | 161 | "position": 1, | ||
162 | "resource_citation": "McGinty. (2019). Lake Windermere Community | 162 | "resource_citation": "McGinty. (2019). Lake Windermere Community | ||
163 | Based Water Quality Monitoring Program 2019 Final Report. Prepared for | 163 | Based Water Quality Monitoring Program 2019 Final Report. Prepared for | ||
164 | Lake Windermere Ambassadors. Columbia Basin Water Hub | 164 | Lake Windermere Ambassadors. Columbia Basin Water Hub | ||
165 | [Resource].\u00a0 Invermere. https://doi.org/10.48511/KBGB-DJ25", | 165 | [Resource].\u00a0 Invermere. https://doi.org/10.48511/KBGB-DJ25", | ||
166 | "resource_data_disclaimer": "No warranty or guarantee exists | 166 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
167 | that the information is accurate, complete, current, or suitable for | 167 | that the information is accurate, complete, current, or suitable for | ||
168 | any purpose. The individual user must confirm the accuracy of the data | 168 | any purpose. The individual user must confirm the accuracy of the data | ||
169 | and whether it will be appropriate for their purpose.", | 169 | and whether it will be appropriate for their purpose.", | ||
170 | "resource_location": "Lake Windermere", | 170 | "resource_location": "Lake Windermere", | ||
171 | "resource_type": null, | 171 | "resource_type": null, | ||
172 | "size": 2320463, | 172 | "size": 2320463, | ||
173 | "state": "active", | 173 | "state": "active", | ||
174 | "url": | 174 | "url": | ||
175 | wa_mcginty_report_lkwindermerewaterqualitymonitoringprogram_2019.pdf", | 175 | wa_mcginty_report_lkwindermerewaterqualitymonitoringprogram_2019.pdf", | ||
176 | "url_type": "upload", | 176 | "url_type": "upload", | ||
177 | "waterhub_certified": "Certified", | 177 | "waterhub_certified": "Certified", | ||
178 | "waterhub_grade": "People and Perspectives" | 178 | "waterhub_grade": "People and Perspectives" | ||
179 | }, | 179 | }, | ||
180 | { | 180 | { | ||
181 | "cache_last_updated": null, | 181 | "cache_last_updated": null, | ||
182 | "cache_url": null, | 182 | "cache_url": null, | ||
183 | "created": "2021-11-23T22:24:53.420732", | 183 | "created": "2021-11-23T22:24:53.420732", | ||
184 | "data_collection_info": "n/a", | 184 | "data_collection_info": "n/a", | ||
185 | "data_processing": "n/a", | 185 | "data_processing": "n/a", | ||
186 | "datastore_active": false, | 186 | "datastore_active": false, | ||
187 | "datastore_status": "", | 187 | "datastore_status": "", | ||
188 | "description": "In 2018, the LWA collected physical and chemical | 188 | "description": "In 2018, the LWA collected physical and chemical | ||
189 | water quality parameters at three sample sites on Lake Windermere. | 189 | water quality parameters at three sample sites on Lake Windermere. | ||
190 | Once weekly during the summer from late May to mid-September, the lake | 190 | Once weekly during the summer from late May to mid-September, the lake | ||
191 | sampling regime included: water temperature, turbidity/clarity, pH, | 191 | sampling regime included: water temperature, turbidity/clarity, pH, | ||
192 | conductivity, depth, and dissolved oxygen. Once monthly from April to | 192 | conductivity, depth, and dissolved oxygen. Once monthly from April to | ||
193 | August, we collected samples for Total and Total Dissolved | 193 | August, we collected samples for Total and Total Dissolved | ||
194 | Phosphorous. The LWA also collected E. coli data at public swim | 194 | Phosphorous. The LWA also collected E. coli data at public swim | ||
195 | beaches in partnership with the Interior Health Authority, and | 195 | beaches in partnership with the Interior Health Authority, and | ||
196 | monitored tributary flows and water quality at the outlet of | 196 | monitored tributary flows and water quality at the outlet of | ||
197 | Windermere Creek and Abel Creek. Lastly, we conducted an aquatic plant | 197 | Windermere Creek and Abel Creek. Lastly, we conducted an aquatic plant | ||
198 | survey as well as a fall waterbird survey on Lake Windermere with the | 198 | survey as well as a fall waterbird survey on Lake Windermere with the | ||
199 | help and expertise of Goldeneye Ecological Services.\r\n", | 199 | help and expertise of Goldeneye Ecological Services.\r\n", | ||
200 | "format": "PDF", | 200 | "format": "PDF", | ||
201 | "hash": "7a5d9b8bb4af9de2305cffe8928edd30", | 201 | "hash": "7a5d9b8bb4af9de2305cffe8928edd30", | ||
202 | "header_row": "", | 202 | "header_row": "", | ||
203 | "id": "aa6c989d-266e-4f8c-a666-fed3782c1cb1", | 203 | "id": "aa6c989d-266e-4f8c-a666-fed3782c1cb1", | ||
204 | "last_modified": "2021-11-23T22:24:53.353134", | 204 | "last_modified": "2021-11-23T22:24:53.353134", | ||
205 | "load_status": "", | 205 | "load_status": "", | ||
206 | "metadata_modified": "2022-05-12T15:01:04.773346", | 206 | "metadata_modified": "2022-05-12T15:01:04.773346", | ||
207 | "mimetype": "application/pdf", | 207 | "mimetype": "application/pdf", | ||
208 | "mimetype_inner": null, | 208 | "mimetype_inner": null, | ||
209 | "name": "Water Quality Monitoring Program 2018 Final Report", | 209 | "name": "Water Quality Monitoring Program 2018 Final Report", | ||
210 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 210 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
211 | "position": 2, | 211 | "position": 2, | ||
212 | "resource_citation": "Rodgers. (2018). Lake Windermere | 212 | "resource_citation": "Rodgers. (2018). Lake Windermere | ||
213 | Community-Based Water Quality Monitoring Program 2018 Final Report. | 213 | Community-Based Water Quality Monitoring Program 2018 Final Report. | ||
214 | Prepared for Lake Windermere Ambassadors. Columbia Basin Water Hub. | 214 | Prepared for Lake Windermere Ambassadors. Columbia Basin Water Hub. | ||
215 | [Resource]. Invermere. https://doi.org/10.48511/KBGB-DJ25", | 215 | [Resource]. Invermere. https://doi.org/10.48511/KBGB-DJ25", | ||
216 | "resource_data_disclaimer": "No warranty or guarantee exists | 216 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
217 | that the information is accurate, complete, current, or suitable for | 217 | that the information is accurate, complete, current, or suitable for | ||
218 | any purpose. The individual user must confirm the accuracy of the data | 218 | any purpose. The individual user must confirm the accuracy of the data | ||
219 | and whether it will be appropriate for their purpose.", | 219 | and whether it will be appropriate for their purpose.", | ||
220 | "resource_location": "Lake Windermere", | 220 | "resource_location": "Lake Windermere", | ||
221 | "resource_type": null, | 221 | "resource_type": null, | ||
222 | "size": 2382873, | 222 | "size": 2382873, | ||
223 | "state": "active", | 223 | "state": "active", | ||
224 | "url": | 224 | "url": | ||
225 | rt_lkwindermerecommunity-basedwaterqualitymonitoringprogram_2018.pdf", | 225 | rt_lkwindermerecommunity-basedwaterqualitymonitoringprogram_2018.pdf", | ||
226 | "url_type": "upload", | 226 | "url_type": "upload", | ||
227 | "waterhub_certified": "Certified", | 227 | "waterhub_certified": "Certified", | ||
228 | "waterhub_grade": "People and Perspectives" | 228 | "waterhub_grade": "People and Perspectives" | ||
229 | }, | 229 | }, | ||
230 | { | 230 | { | ||
231 | "cache_last_updated": null, | 231 | "cache_last_updated": null, | ||
232 | "cache_url": null, | 232 | "cache_url": null, | ||
233 | "created": "2021-11-23T22:37:40.342909", | 233 | "created": "2021-11-23T22:37:40.342909", | ||
234 | "data_collection_info": "n/a", | 234 | "data_collection_info": "n/a", | ||
235 | "data_processing": "n/a", | 235 | "data_processing": "n/a", | ||
236 | "datastore_active": false, | 236 | "datastore_active": false, | ||
237 | "datastore_status": "", | 237 | "datastore_status": "", | ||
238 | "description": "In 2017, the LWA collected physical and chemical | 238 | "description": "In 2017, the LWA collected physical and chemical | ||
239 | water quality parameters at three sample sites on Lake Windermere. | 239 | water quality parameters at three sample sites on Lake Windermere. | ||
240 | Once weekly during the summer from mid-June to mid-September, the lake | 240 | Once weekly during the summer from mid-June to mid-September, the lake | ||
241 | sampling regime included: temperature, turbidity/clarity, pH, | 241 | sampling regime included: temperature, turbidity/clarity, pH, | ||
242 | conductivity, depth, dissolved oxygen, and Total and Dissolved | 242 | conductivity, depth, dissolved oxygen, and Total and Dissolved | ||
243 | Phosphorous. The LWA also collected E. coli data at public swim | 243 | Phosphorous. The LWA also collected E. coli data at public swim | ||
244 | beaches with the support of the Interior Health Authority, and | 244 | beaches with the support of the Interior Health Authority, and | ||
245 | monitored tributary flows and water quality at the outlet of | 245 | monitored tributary flows and water quality at the outlet of | ||
246 | Windermere Creek with the support of the Columbia Basin Water Quality | 246 | Windermere Creek with the support of the Columbia Basin Water Quality | ||
247 | Monitoring Project (CBWQ). Finally, we conducted an aquatic plant and | 247 | Monitoring Project (CBWQ). Finally, we conducted an aquatic plant and | ||
248 | invasive veliger survey with the help and expertise of the East | 248 | invasive veliger survey with the help and expertise of the East | ||
249 | Kootenay Invasive Species Council and Goldeneye Ecological Services.", | 249 | Kootenay Invasive Species Council and Goldeneye Ecological Services.", | ||
250 | "format": "PDF", | 250 | "format": "PDF", | ||
251 | "hash": "", | 251 | "hash": "", | ||
252 | "header_row": "", | 252 | "header_row": "", | ||
253 | "id": "8d13ec2c-6a7b-4dab-bb00-ff525d787063", | 253 | "id": "8d13ec2c-6a7b-4dab-bb00-ff525d787063", | ||
254 | "last_modified": null, | 254 | "last_modified": null, | ||
255 | "load_status": "", | 255 | "load_status": "", | ||
256 | "metadata_modified": "2022-05-12T15:02:25.990121", | 256 | "metadata_modified": "2022-05-12T15:02:25.990121", | ||
257 | "mimetype": null, | 257 | "mimetype": null, | ||
258 | "mimetype_inner": null, | 258 | "mimetype_inner": null, | ||
259 | "name": "Lake Windermere 2017 Water Quality Monitoring Results", | 259 | "name": "Lake Windermere 2017 Water Quality Monitoring Results", | ||
260 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 260 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
261 | "position": 3, | 261 | "position": 3, | ||
262 | "resource_citation": "Rodgers. (2017). Lake Windermere 2017 | 262 | "resource_citation": "Rodgers. (2017). Lake Windermere 2017 | ||
263 | Water Quality Monitoring Results. Prepared for Lake Windermere | 263 | Water Quality Monitoring Results. Prepared for Lake Windermere | ||
264 | Ambassadors. Columbia Basin Water Hub [Resource].\u00a0Invermere | 264 | Ambassadors. Columbia Basin Water Hub [Resource].\u00a0Invermere | ||
265 | https://doi.org/10.48511/KBGB-DJ25", | 265 | https://doi.org/10.48511/KBGB-DJ25", | ||
266 | "resource_data_disclaimer": "No warranty or guarantee exists | 266 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
267 | that the information is accurate, complete, current, or suitable for | 267 | that the information is accurate, complete, current, or suitable for | ||
268 | any purpose. The individual user must confirm the accuracy of the data | 268 | any purpose. The individual user must confirm the accuracy of the data | ||
269 | and whether it will be appropriate for their purpose.", | 269 | and whether it will be appropriate for their purpose.", | ||
270 | "resource_location": "Lake Windermere", | 270 | "resource_location": "Lake Windermere", | ||
271 | "resource_type": null, | 271 | "resource_type": null, | ||
272 | "size": null, | 272 | "size": null, | ||
273 | "state": "active", | 273 | "state": "active", | ||
274 | "url": "", | 274 | "url": "", | ||
275 | "url_type": null, | 275 | "url_type": null, | ||
276 | "waterhub_certified": "Certified", | 276 | "waterhub_certified": "Certified", | ||
277 | "waterhub_grade": "People and Perspectives" | 277 | "waterhub_grade": "People and Perspectives" | ||
278 | }, | 278 | }, | ||
279 | { | 279 | { | ||
280 | "cache_last_updated": null, | 280 | "cache_last_updated": null, | ||
281 | "cache_url": null, | 281 | "cache_url": null, | ||
282 | "created": "2021-11-23T22:49:43.365126", | 282 | "created": "2021-11-23T22:49:43.365126", | ||
283 | "data_collection_info": "n/a", | 283 | "data_collection_info": "n/a", | ||
284 | "data_processing": "n/a", | 284 | "data_processing": "n/a", | ||
285 | "datastore_active": false, | 285 | "datastore_active": false, | ||
286 | "datastore_status": "", | 286 | "datastore_status": "", | ||
287 | "description": "2016 marked the eleventh year of lake monitoring | 287 | "description": "2016 marked the eleventh year of lake monitoring | ||
288 | since the Lake Windermere Project started data collection in 2006. The | 288 | since the Lake Windermere Project started data collection in 2006. The | ||
289 | spring and summer of 2014-2016 brought mild climatic conditions | 289 | spring and summer of 2014-2016 brought mild climatic conditions | ||
290 | without the major flooding events which characterized 2012-2013. | 290 | without the major flooding events which characterized 2012-2013. | ||
291 | Measured lake depths in 2016 were comparable to those in 2006-2008, | 291 | Measured lake depths in 2016 were comparable to those in 2006-2008, | ||
292 | and shallower than average levels in more recent years (2012, 2014). | 292 | and shallower than average levels in more recent years (2012, 2014). | ||
293 | Lake Windermere met Objectives for temperature, dissolved oxygen, and | 293 | Lake Windermere met Objectives for temperature, dissolved oxygen, and | ||
294 | turbidity throughout the summer. This means the water was clear, cool, | 294 | turbidity throughout the summer. This means the water was clear, cool, | ||
295 | and well oxygenated: all in line with historic levels. Beach | 295 | and well oxygenated: all in line with historic levels. Beach | ||
296 | monitoring results showed that shoreline bacteria levels did not | 296 | monitoring results showed that shoreline bacteria levels did not | ||
297 | exceed the recommended Guidelines for safe swimming on any of Lake | 297 | exceed the recommended Guidelines for safe swimming on any of Lake | ||
298 | Windermere\u2019s public beaches over the summer.", | 298 | Windermere\u2019s public beaches over the summer.", | ||
299 | "format": "PDF", | 299 | "format": "PDF", | ||
300 | "hash": "2273882fe388dc8ddcc3350075dccb34", | 300 | "hash": "2273882fe388dc8ddcc3350075dccb34", | ||
301 | "header_row": "", | 301 | "header_row": "", | ||
302 | "id": "f9919c08-5a37-4277-9c64-4fca6cb1e3ed", | 302 | "id": "f9919c08-5a37-4277-9c64-4fca6cb1e3ed", | ||
303 | "last_modified": "2021-11-23T22:49:43.289338", | 303 | "last_modified": "2021-11-23T22:49:43.289338", | ||
304 | "load_status": "", | 304 | "load_status": "", | ||
305 | "metadata_modified": "2022-05-12T15:05:19.631346", | 305 | "metadata_modified": "2022-05-12T15:05:19.631346", | ||
306 | "mimetype": "application/pdf", | 306 | "mimetype": "application/pdf", | ||
307 | "mimetype_inner": null, | 307 | "mimetype_inner": null, | ||
308 | "name": "Lake Windermere 2016 Water Quality Monitoring Results", | 308 | "name": "Lake Windermere 2016 Water Quality Monitoring Results", | ||
309 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 309 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
310 | "position": 4, | 310 | "position": 4, | ||
311 | "resource_citation": "Peloso. (2017). Lake Windermere 2016 Water | 311 | "resource_citation": "Peloso. (2017). Lake Windermere 2016 Water | ||
312 | Quality Monitoring Results. Prepared for Lake Windermere Ambassadors. | 312 | Quality Monitoring Results. Prepared for Lake Windermere Ambassadors. | ||
313 | Columbia Basin Water Hub [Resource].\u00a0Invermere. | 313 | Columbia Basin Water Hub [Resource].\u00a0Invermere. | ||
314 | https://doi.org/10.48511/KBGB-DJ25", | 314 | https://doi.org/10.48511/KBGB-DJ25", | ||
315 | "resource_data_disclaimer": "No warranty or guarantee exists | 315 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
316 | that the information is accurate, complete, current, or suitable for | 316 | that the information is accurate, complete, current, or suitable for | ||
317 | any purpose. The individual user must confirm the accuracy of the data | 317 | any purpose. The individual user must confirm the accuracy of the data | ||
318 | and whether it will be appropriate for their purpose.", | 318 | and whether it will be appropriate for their purpose.", | ||
319 | "resource_location": "Lake Windermere", | 319 | "resource_location": "Lake Windermere", | ||
320 | "resource_type": null, | 320 | "resource_type": null, | ||
321 | "size": 1299939, | 321 | "size": 1299939, | ||
322 | "state": "active", | 322 | "state": "active", | ||
323 | "url": | 323 | "url": | ||
324 | loso_report_lakewindermere2016waterqualitymonitoringresults_2016.pdf", | 324 | loso_report_lakewindermere2016waterqualitymonitoringresults_2016.pdf", | ||
325 | "url_type": "upload", | 325 | "url_type": "upload", | ||
326 | "waterhub_certified": "Certified", | 326 | "waterhub_certified": "Certified", | ||
327 | "waterhub_grade": "People and Perspectives" | 327 | "waterhub_grade": "People and Perspectives" | ||
328 | }, | 328 | }, | ||
329 | { | 329 | { | ||
330 | "cache_last_updated": null, | 330 | "cache_last_updated": null, | ||
331 | "cache_url": null, | 331 | "cache_url": null, | ||
332 | "created": "2021-11-23T23:05:34.834141", | 332 | "created": "2021-11-23T23:05:34.834141", | ||
333 | "data_collection_info": "n/a", | 333 | "data_collection_info": "n/a", | ||
334 | "data_processing": "n/a", | 334 | "data_processing": "n/a", | ||
335 | "datastore_active": false, | 335 | "datastore_active": false, | ||
336 | "datastore_status": "", | 336 | "datastore_status": "", | ||
337 | "description": "2015 marked the tenth year of lake monitoring | 337 | "description": "2015 marked the tenth year of lake monitoring | ||
338 | since the Lake Windermere Project started data collection in 2006. The | 338 | since the Lake Windermere Project started data collection in 2006. The | ||
339 | spring and summer of 2014 and 2015 brought mild climatic conditions | 339 | spring and summer of 2014 and 2015 brought mild climatic conditions | ||
340 | without the major flooding events which characterized 2012 and 2013. | 340 | without the major flooding events which characterized 2012 and 2013. | ||
341 | Measured lake depths in 2015 were comparable to those in 2006-2008, | 341 | Measured lake depths in 2015 were comparable to those in 2006-2008, | ||
342 | and shallower than average levels in more recent years (2012, 2014). | 342 | and shallower than average levels in more recent years (2012, 2014). | ||
343 | Lake Windermere met Objectives for temperature, dissolved oxygen, and | 343 | Lake Windermere met Objectives for temperature, dissolved oxygen, and | ||
344 | turbidity throughout the summer. This means the water was clear, cool, | 344 | turbidity throughout the summer. This means the water was clear, cool, | ||
345 | and well oxygenated: all in line with historic levels. Beach | 345 | and well oxygenated: all in line with historic levels. Beach | ||
346 | monitoring results show that shoreline bacteria levels did not exceed | 346 | monitoring results show that shoreline bacteria levels did not exceed | ||
347 | the recommended Guidelines for safe swimming on any of Lake | 347 | the recommended Guidelines for safe swimming on any of Lake | ||
348 | Windermere\u2019s public beaches over the summer.\r\nTotal phosphorus | 348 | Windermere\u2019s public beaches over the summer.\r\nTotal phosphorus | ||
349 | levels at ice-off exceeded the Objective for the Lake at two sampling | 349 | levels at ice-off exceeded the Objective for the Lake at two sampling | ||
350 | stations in 2015. A slight increasing trend in this nutrient has been | 350 | stations in 2015. A slight increasing trend in this nutrient has been | ||
351 | observed in the lake in recent years, warranting continued monitoring | 351 | observed in the lake in recent years, warranting continued monitoring | ||
352 | in conjunction with efforts on land to keep excess nutrients out of | 352 | in conjunction with efforts on land to keep excess nutrients out of | ||
353 | the lake.", | 353 | the lake.", | ||
354 | "format": "PDF", | 354 | "format": "PDF", | ||
355 | "hash": "0a33c447193b2f26f74036fde504639c", | 355 | "hash": "0a33c447193b2f26f74036fde504639c", | ||
356 | "header_row": "", | 356 | "header_row": "", | ||
357 | "id": "d27e444f-a734-4e40-bc8d-56fc4f3f4755", | 357 | "id": "d27e444f-a734-4e40-bc8d-56fc4f3f4755", | ||
358 | "last_modified": "2021-11-23T23:05:34.756954", | 358 | "last_modified": "2021-11-23T23:05:34.756954", | ||
359 | "load_status": "", | 359 | "load_status": "", | ||
360 | "metadata_modified": "2022-05-12T15:06:38.231833", | 360 | "metadata_modified": "2022-05-12T15:06:38.231833", | ||
361 | "mimetype": "application/pdf", | 361 | "mimetype": "application/pdf", | ||
362 | "mimetype_inner": null, | 362 | "mimetype_inner": null, | ||
363 | "name": "Lake Windermere 2015 Water Quality Monitoring Results", | 363 | "name": "Lake Windermere 2015 Water Quality Monitoring Results", | ||
364 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 364 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
365 | "position": 5, | 365 | "position": 5, | ||
366 | "resource_citation": "Peloso. (2016). Lake Windermere 2015 Water | 366 | "resource_citation": "Peloso. (2016). Lake Windermere 2015 Water | ||
367 | Quality Monitoring Results. Prepared for Lake Windermere Ambassadors. | 367 | Quality Monitoring Results. Prepared for Lake Windermere Ambassadors. | ||
368 | Columbia Basin Water Hub [Resource].\u00a0Invermere. | 368 | Columbia Basin Water Hub [Resource].\u00a0Invermere. | ||
369 | https://doi.org/10.48511/KBGB-DJ25", | 369 | https://doi.org/10.48511/KBGB-DJ25", | ||
370 | "resource_data_disclaimer": "No warranty or guarantee exists | 370 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
371 | that the information is accurate, complete, current, or suitable for | 371 | that the information is accurate, complete, current, or suitable for | ||
372 | any purpose. The individual user must confirm the accuracy of the data | 372 | any purpose. The individual user must confirm the accuracy of the data | ||
373 | and whether it will be appropriate for their purpose.", | 373 | and whether it will be appropriate for their purpose.", | ||
374 | "resource_location": "Lake Windermere", | 374 | "resource_location": "Lake Windermere", | ||
375 | "resource_type": null, | 375 | "resource_type": null, | ||
376 | "size": 1182081, | 376 | "size": 1182081, | ||
377 | "state": "active", | 377 | "state": "active", | ||
378 | "url": | 378 | "url": | ||
379 | peloso_report_lkwindermere2015waterqualitymonitoringresults_2015.pdf", | 379 | peloso_report_lkwindermere2015waterqualitymonitoringresults_2015.pdf", | ||
380 | "url_type": "upload", | 380 | "url_type": "upload", | ||
381 | "waterhub_certified": "Certified", | 381 | "waterhub_certified": "Certified", | ||
382 | "waterhub_grade": "People and Perspectives" | 382 | "waterhub_grade": "People and Perspectives" | ||
383 | }, | 383 | }, | ||
384 | { | 384 | { | ||
385 | "cache_last_updated": null, | 385 | "cache_last_updated": null, | ||
386 | "cache_url": null, | 386 | "cache_url": null, | ||
387 | "created": "2021-11-23T23:13:35.771622", | 387 | "created": "2021-11-23T23:13:35.771622", | ||
388 | "data_collection_info": "n/a", | 388 | "data_collection_info": "n/a", | ||
389 | "data_processing": "n/a", | 389 | "data_processing": "n/a", | ||
390 | "datastore_active": false, | 390 | "datastore_active": false, | ||
391 | "datastore_status": "", | 391 | "datastore_status": "", | ||
392 | "description": "The spring and summer of 2014 brought mild | 392 | "description": "The spring and summer of 2014 brought mild | ||
393 | climatic conditions without the major flooding events which | 393 | climatic conditions without the major flooding events which | ||
394 | characterized 2012 and 2013. The measured lake depths in 2014 were | 394 | characterized 2012 and 2013. The measured lake depths in 2014 were | ||
395 | comparable to those in 2012, and deeper than average levels between | 395 | comparable to those in 2012, and deeper than average levels between | ||
396 | 2006-2008 and 2011. Lake Windermere met Objectives for temperature, | 396 | 2006-2008 and 2011. Lake Windermere met Objectives for temperature, | ||
397 | dissolved oxygen, and turbidity throughout the summer. This means the | 397 | dissolved oxygen, and turbidity throughout the summer. This means the | ||
398 | water was clear, cool, and well oxygenated: all in line with historic | 398 | water was clear, cool, and well oxygenated: all in line with historic | ||
399 | levels. The beaches were clean in 2014. Measured beach bacteria levels | 399 | levels. The beaches were clean in 2014. Measured beach bacteria levels | ||
400 | did not exceed the recommended Guidelines for safe swimming on any of | 400 | did not exceed the recommended Guidelines for safe swimming on any of | ||
401 | the public beaches over the summer.\r\nTotal phosphorus levels | 401 | the public beaches over the summer.\r\nTotal phosphorus levels | ||
402 | exceeded the Objective for the Lake at one sampling station in 2014. A | 402 | exceeded the Objective for the Lake at one sampling station in 2014. A | ||
403 | slight increasing trend in this nutrient has been observed in the lake | 403 | slight increasing trend in this nutrient has been observed in the lake | ||
404 | in recent years, warranting close monitoring of this critical nutrient | 404 | in recent years, warranting close monitoring of this critical nutrient | ||
405 | and continued efforts on land to keep excess nutrients out of the | 405 | and continued efforts on land to keep excess nutrients out of the | ||
406 | lake.", | 406 | lake.", | ||
407 | "format": "PDF", | 407 | "format": "PDF", | ||
408 | "hash": "e334758dfd79acfeccd9491fa45c4147", | 408 | "hash": "e334758dfd79acfeccd9491fa45c4147", | ||
409 | "header_row": "", | 409 | "header_row": "", | ||
410 | "id": "7c715f2d-aeb5-416d-b153-98e7e9b6c60c", | 410 | "id": "7c715f2d-aeb5-416d-b153-98e7e9b6c60c", | ||
411 | "last_modified": "2021-12-08T21:32:37.277837", | 411 | "last_modified": "2021-12-08T21:32:37.277837", | ||
412 | "load_status": "", | 412 | "load_status": "", | ||
413 | "metadata_modified": "2022-05-12T15:09:00.444722", | 413 | "metadata_modified": "2022-05-12T15:09:00.444722", | ||
414 | "mimetype": "application/pdf", | 414 | "mimetype": "application/pdf", | ||
415 | "mimetype_inner": null, | 415 | "mimetype_inner": null, | ||
416 | "name": "Lake Windermere 2014 Water Quality Monitoring Results", | 416 | "name": "Lake Windermere 2014 Water Quality Monitoring Results", | ||
417 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 417 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
418 | "position": 6, | 418 | "position": 6, | ||
419 | "resource_citation": "Harma. (2014). Lake Windermere 2014 Water | 419 | "resource_citation": "Harma. (2014). Lake Windermere 2014 Water | ||
420 | Quality Monitoring Results. Prepared for Lake Windermere Ambassadors. | 420 | Quality Monitoring Results. Prepared for Lake Windermere Ambassadors. | ||
421 | Columbia Basin Water Hub [Resource].\u00a0Invermere. | 421 | Columbia Basin Water Hub [Resource].\u00a0Invermere. | ||
422 | https://doi.org/10.48511/KBGB-DJ25", | 422 | https://doi.org/10.48511/KBGB-DJ25", | ||
423 | "resource_data_disclaimer": "No warranty or guarantee exists | 423 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
424 | that the information is accurate, complete, current, or suitable for | 424 | that the information is accurate, complete, current, or suitable for | ||
425 | any purpose. The individual user must confirm the accuracy of the data | 425 | any purpose. The individual user must confirm the accuracy of the data | ||
426 | and whether it will be appropriate for their purpose.", | 426 | and whether it will be appropriate for their purpose.", | ||
427 | "resource_location": "Lake Windermere", | 427 | "resource_location": "Lake Windermere", | ||
428 | "resource_type": null, | 428 | "resource_type": null, | ||
429 | "size": 857404, | 429 | "size": 857404, | ||
430 | "state": "active", | 430 | "state": "active", | ||
431 | "url": | 431 | "url": | ||
432 | _harma_report_lkwindermere2014waterqualitymonitoringresults_2014.pdf", | 432 | _harma_report_lkwindermere2014waterqualitymonitoringresults_2014.pdf", | ||
433 | "url_type": "upload", | 433 | "url_type": "upload", | ||
434 | "waterhub_certified": "Certified", | 434 | "waterhub_certified": "Certified", | ||
435 | "waterhub_grade": "People and Perspectives" | 435 | "waterhub_grade": "People and Perspectives" | ||
436 | }, | 436 | }, | ||
437 | { | 437 | { | ||
438 | "cache_last_updated": null, | 438 | "cache_last_updated": null, | ||
439 | "cache_url": null, | 439 | "cache_url": null, | ||
440 | "created": "2021-11-23T23:20:00.004349", | 440 | "created": "2021-11-23T23:20:00.004349", | ||
441 | "data_collection_info": "n/a", | 441 | "data_collection_info": "n/a", | ||
442 | "data_processing": "n/a", | 442 | "data_processing": "n/a", | ||
443 | "datastore_active": false, | 443 | "datastore_active": false, | ||
444 | "datastore_status": "", | 444 | "datastore_status": "", | ||
445 | "description": "In 2013, Lake Windermere Ambassadors\u2019 | 445 | "description": "In 2013, Lake Windermere Ambassadors\u2019 | ||
446 | volunteers and staff sampled lake water at three locations monitored | 446 | volunteers and staff sampled lake water at three locations monitored | ||
447 | historically by the Ministry of Environment and then by the Lake | 447 | historically by the Ministry of Environment and then by the Lake | ||
448 | Windermere Project. The sites cover the North and South end and center | 448 | Windermere Project. The sites cover the North and South end and center | ||
449 | (Mid) of the lake.", | 449 | (Mid) of the lake.", | ||
450 | "format": "PDF", | 450 | "format": "PDF", | ||
451 | "hash": "bdb58a784524585c0227d709834fcbf6", | 451 | "hash": "bdb58a784524585c0227d709834fcbf6", | ||
452 | "header_row": "", | 452 | "header_row": "", | ||
453 | "id": "c7780c0f-2ffd-4ed9-96b1-c2f502aebf94", | 453 | "id": "c7780c0f-2ffd-4ed9-96b1-c2f502aebf94", | ||
454 | "last_modified": "2021-11-23T23:19:59.923080", | 454 | "last_modified": "2021-11-23T23:19:59.923080", | ||
455 | "load_status": "", | 455 | "load_status": "", | ||
456 | "metadata_modified": "2022-05-12T15:10:09.115268", | 456 | "metadata_modified": "2022-05-12T15:10:09.115268", | ||
457 | "mimetype": "application/pdf", | 457 | "mimetype": "application/pdf", | ||
458 | "mimetype_inner": null, | 458 | "mimetype_inner": null, | ||
459 | "name": "Lake Windermere 2013 Water Quality Monitoring Results", | 459 | "name": "Lake Windermere 2013 Water Quality Monitoring Results", | ||
460 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 460 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
461 | "position": 7, | 461 | "position": 7, | ||
462 | "resource_citation": "Lake Windermere Ambassadors. (2013). Lake | 462 | "resource_citation": "Lake Windermere Ambassadors. (2013). Lake | ||
463 | Windermere 2013 Water Quality Monitoring Results. Columbia Basin Water | 463 | Windermere 2013 Water Quality Monitoring Results. Columbia Basin Water | ||
464 | Hub [Resource].\u00a0Invermere. https://doi.org/10.48511/KBGB-DJ25", | 464 | Hub [Resource].\u00a0Invermere. https://doi.org/10.48511/KBGB-DJ25", | ||
465 | "resource_data_disclaimer": "No warranty or guarantee exists | 465 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
466 | that the information is accurate, complete, current, or suitable for | 466 | that the information is accurate, complete, current, or suitable for | ||
467 | any purpose. The individual user must confirm the accuracy of the data | 467 | any purpose. The individual user must confirm the accuracy of the data | ||
468 | and whether it will be appropriate for their purpose.", | 468 | and whether it will be appropriate for their purpose.", | ||
469 | "resource_location": "Lake Windermere", | 469 | "resource_location": "Lake Windermere", | ||
470 | "resource_type": null, | 470 | "resource_type": null, | ||
471 | "size": 1093839, | 471 | "size": 1093839, | ||
472 | "state": "active", | 472 | "state": "active", | ||
473 | "url": | 473 | "url": | ||
474 | sadors_report_lkwindermere2013waterqualitymonitoringresults_2013.pdf", | 474 | sadors_report_lkwindermere2013waterqualitymonitoringresults_2013.pdf", | ||
475 | "url_type": "upload", | 475 | "url_type": "upload", | ||
476 | "waterhub_certified": "Certified", | 476 | "waterhub_certified": "Certified", | ||
477 | "waterhub_grade": "People and Perspectives" | 477 | "waterhub_grade": "People and Perspectives" | ||
478 | }, | 478 | }, | ||
479 | { | 479 | { | ||
480 | "cache_last_updated": null, | 480 | "cache_last_updated": null, | ||
481 | "cache_url": null, | 481 | "cache_url": null, | ||
482 | "created": "2021-11-23T23:23:42.836926", | 482 | "created": "2021-11-23T23:23:42.836926", | ||
483 | "data_collection_info": "n/a", | 483 | "data_collection_info": "n/a", | ||
484 | "data_processing": "n/a", | 484 | "data_processing": "n/a", | ||
485 | "datastore_active": false, | 485 | "datastore_active": false, | ||
486 | "datastore_status": "", | 486 | "datastore_status": "", | ||
487 | "description": "In 2012 Lake Windermere Ambassadors\u2019 | 487 | "description": "In 2012 Lake Windermere Ambassadors\u2019 | ||
488 | volunteers and staff sampled lake water at three locations established | 488 | volunteers and staff sampled lake water at three locations established | ||
489 | by the Ministry of Environment and sampled over 5 years by the Lake | 489 | by the Ministry of Environment and sampled over 5 years by the Lake | ||
490 | Windermere Project. The sites cover the north and south end and center | 490 | Windermere Project. The sites cover the north and south end and center | ||
491 | of the lake.", | 491 | of the lake.", | ||
492 | "format": "PDF", | 492 | "format": "PDF", | ||
493 | "hash": "ad2d38e5d5b1caffd6a5abfe4c726287", | 493 | "hash": "ad2d38e5d5b1caffd6a5abfe4c726287", | ||
494 | "header_row": "", | 494 | "header_row": "", | ||
495 | "id": "67b8ff61-5811-4c87-bce3-86c79e22822b", | 495 | "id": "67b8ff61-5811-4c87-bce3-86c79e22822b", | ||
496 | "last_modified": "2021-11-23T23:23:42.751096", | 496 | "last_modified": "2021-11-23T23:23:42.751096", | ||
497 | "load_status": "", | 497 | "load_status": "", | ||
498 | "metadata_modified": "2022-05-12T15:11:16.926547", | 498 | "metadata_modified": "2022-05-12T15:11:16.926547", | ||
499 | "mimetype": "application/pdf", | 499 | "mimetype": "application/pdf", | ||
500 | "mimetype_inner": null, | 500 | "mimetype_inner": null, | ||
501 | "name": "Lake Windermere 2012 Water Quality Monitoring Results", | 501 | "name": "Lake Windermere 2012 Water Quality Monitoring Results", | ||
502 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 502 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
503 | "position": 8, | 503 | "position": 8, | ||
504 | "resource_citation": "Lake Windermere Ambassadors. (2012). Lake | 504 | "resource_citation": "Lake Windermere Ambassadors. (2012). Lake | ||
505 | Windermere 2012 Water Quality Monitoring Results. Columbia Basin Water | 505 | Windermere 2012 Water Quality Monitoring Results. Columbia Basin Water | ||
506 | Hub [Resource].\u00a0Invermere. https://doi.org/10.48511/KBGB-DJ25", | 506 | Hub [Resource].\u00a0Invermere. https://doi.org/10.48511/KBGB-DJ25", | ||
507 | "resource_data_disclaimer": "No warranty or guarantee exists | 507 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
508 | that the information is accurate, complete, current, or suitable for | 508 | that the information is accurate, complete, current, or suitable for | ||
509 | any purpose. The individual user must confirm the accuracy of the data | 509 | any purpose. The individual user must confirm the accuracy of the data | ||
510 | and whether it will be appropriate for their purpose.", | 510 | and whether it will be appropriate for their purpose.", | ||
511 | "resource_location": "Lake Windermere", | 511 | "resource_location": "Lake Windermere", | ||
512 | "resource_type": null, | 512 | "resource_type": null, | ||
513 | "size": 1603461, | 513 | "size": 1603461, | ||
514 | "state": "active", | 514 | "state": "active", | ||
515 | "url": | 515 | "url": | ||
516 | sadors_report_lkwindermere2012waterqualitymonitoringresults_2012.pdf", | 516 | sadors_report_lkwindermere2012waterqualitymonitoringresults_2012.pdf", | ||
517 | "url_type": "upload", | 517 | "url_type": "upload", | ||
518 | "waterhub_certified": "Certified", | 518 | "waterhub_certified": "Certified", | ||
519 | "waterhub_grade": "People and Perspectives" | 519 | "waterhub_grade": "People and Perspectives" | ||
520 | }, | 520 | }, | ||
521 | { | 521 | { | ||
522 | "cache_last_updated": null, | 522 | "cache_last_updated": null, | ||
523 | "cache_url": null, | 523 | "cache_url": null, | ||
524 | "created": "2021-11-23T23:27:43.105066", | 524 | "created": "2021-11-23T23:27:43.105066", | ||
525 | "data_collection_info": "n/a", | 525 | "data_collection_info": "n/a", | ||
526 | "data_processing": "n/a", | 526 | "data_processing": "n/a", | ||
527 | "datastore_active": false, | 527 | "datastore_active": false, | ||
528 | "datastore_status": "", | 528 | "datastore_status": "", | ||
529 | "description": "In 2011 Lake Windermere Ambassadors\u2019 | 529 | "description": "In 2011 Lake Windermere Ambassadors\u2019 | ||
530 | volunteers and staff sampled lake water at three locations established | 530 | volunteers and staff sampled lake water at three locations established | ||
531 | by the Ministry of Environment and sampled over the previous 5 years | 531 | by the Ministry of Environment and sampled over the previous 5 years | ||
532 | by the Lake Windermere Project. The sites cover the north and south | 532 | by the Lake Windermere Project. The sites cover the north and south | ||
533 | end and center of the lake.", | 533 | end and center of the lake.", | ||
534 | "format": "PDF", | 534 | "format": "PDF", | ||
535 | "hash": "2f17535074d077048b73718bf4fc99ed", | 535 | "hash": "2f17535074d077048b73718bf4fc99ed", | ||
536 | "header_row": "", | 536 | "header_row": "", | ||
537 | "id": "dcf1f2c2-9ce2-4bc3-a8c8-7b0719be9dd5", | 537 | "id": "dcf1f2c2-9ce2-4bc3-a8c8-7b0719be9dd5", | ||
538 | "last_modified": "2021-11-23T23:27:43.016982", | 538 | "last_modified": "2021-11-23T23:27:43.016982", | ||
539 | "load_status": "Invalid header row: ", | 539 | "load_status": "Invalid header row: ", | ||
540 | "metadata_modified": "2022-05-12T15:12:20.025376", | 540 | "metadata_modified": "2022-05-12T15:12:20.025376", | ||
541 | "mimetype": "application/pdf", | 541 | "mimetype": "application/pdf", | ||
542 | "mimetype_inner": null, | 542 | "mimetype_inner": null, | ||
543 | "name": "Lake Windermere 2011 Water Quality Monitoring Results", | 543 | "name": "Lake Windermere 2011 Water Quality Monitoring Results", | ||
544 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 544 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
545 | "position": 9, | 545 | "position": 9, | ||
546 | "resource_citation": "Lake Windermere Ambassadors. (2011). Lake | 546 | "resource_citation": "Lake Windermere Ambassadors. (2011). Lake | ||
547 | Windermere 2011 Water Quality Monitoring Results. Columbia Basin | 547 | Windermere 2011 Water Quality Monitoring Results. Columbia Basin | ||
548 | Water Hub [Resource].\u00a0Invermere. | 548 | Water Hub [Resource].\u00a0Invermere. | ||
549 | https://doi.org/10.48511/KBGB-DJ25", | 549 | https://doi.org/10.48511/KBGB-DJ25", | ||
550 | "resource_data_disclaimer": "No warranty or guarantee exists | 550 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
551 | that the information is accurate, complete, current, or suitable for | 551 | that the information is accurate, complete, current, or suitable for | ||
552 | any purpose. The individual user must confirm the accuracy of the data | 552 | any purpose. The individual user must confirm the accuracy of the data | ||
553 | and whether it will be appropriate for their purpose.", | 553 | and whether it will be appropriate for their purpose.", | ||
554 | "resource_location": "Lake Windermere", | 554 | "resource_location": "Lake Windermere", | ||
555 | "resource_type": null, | 555 | "resource_type": null, | ||
556 | "size": 1593707, | 556 | "size": 1593707, | ||
557 | "state": "active", | 557 | "state": "active", | ||
558 | "url": | 558 | "url": | ||
559 | sadors_report_lkwindermere2011waterqualitymonitoringresults_2011.pdf", | 559 | sadors_report_lkwindermere2011waterqualitymonitoringresults_2011.pdf", | ||
560 | "url_type": "upload", | 560 | "url_type": "upload", | ||
561 | "waterhub_certified": "Certified", | 561 | "waterhub_certified": "Certified", | ||
562 | "waterhub_grade": "People and Perspectives" | 562 | "waterhub_grade": "People and Perspectives" | ||
563 | }, | 563 | }, | ||
564 | { | 564 | { | ||
565 | "cache_last_updated": null, | 565 | "cache_last_updated": null, | ||
566 | "cache_url": null, | 566 | "cache_url": null, | ||
567 | "created": "2021-11-23T23:35:04.672563", | 567 | "created": "2021-11-23T23:35:04.672563", | ||
568 | "data_collection_info": "n/a", | 568 | "data_collection_info": "n/a", | ||
569 | "data_processing": "n/a", | 569 | "data_processing": "n/a", | ||
570 | "datastore_active": false, | 570 | "datastore_active": false, | ||
571 | "datastore_status": "", | 571 | "datastore_status": "", | ||
572 | "description": "The objectives of this water quality monitoring | 572 | "description": "The objectives of this water quality monitoring | ||
573 | report are as follows:\r\n1. Present CABIN, sediment and water | 573 | report are as follows:\r\n1. Present CABIN, sediment and water | ||
574 | quality, and continual stream temperature data collected to date in a | 574 | quality, and continual stream temperature data collected to date in a | ||
575 | format that can be used for analysis and ongoing assessment.\r\n2. | 575 | format that can be used for analysis and ongoing assessment.\r\n2. | ||
576 | Analyse biological monitoring data (CABIN). Complete the analysis | 576 | Analyse biological monitoring data (CABIN). Complete the analysis | ||
577 | using the analytical tools in the CABIN database by classifying | 577 | using the analytical tools in the CABIN database by classifying | ||
578 | benthic invertebrate community stress at sampling sites according the | 578 | benthic invertebrate community stress at sampling sites according the | ||
579 | Reference Condition Approach and calculating invertebrate community | 579 | Reference Condition Approach and calculating invertebrate community | ||
580 | metrics.\r\n3. Analyse water and sediment quality data to identify if | 580 | metrics.\r\n3. Analyse water and sediment quality data to identify if | ||
581 | there were any parameters of potential concern in the study area. | 581 | there were any parameters of potential concern in the study area. | ||
582 | Complete this review by comparing monitoring results to applicable | 582 | Complete this review by comparing monitoring results to applicable | ||
583 | federal and provincial guidelines for the protection of aquatic life | 583 | federal and provincial guidelines for the protection of aquatic life | ||
584 | and drinking water, where available.\r\n4. Analyse stream temperature | 584 | and drinking water, where available.\r\n4. Analyse stream temperature | ||
585 | data obtained from the continual data logger(s).\r\n5. Relate | 585 | data obtained from the continual data logger(s).\r\n5. Relate | ||
586 | biological results to water/sediment quality and stream temperature | 586 | biological results to water/sediment quality and stream temperature | ||
587 | findings.\r\n6. Provide recommendations for future stream health data | 587 | findings.\r\n6. Provide recommendations for future stream health data | ||
588 | collection including applicable data to be collected, locations to be | 588 | collection including applicable data to be collected, locations to be | ||
589 | sampled, and procedures.", | 589 | sampled, and procedures.", | ||
590 | "format": "PDF", | 590 | "format": "PDF", | ||
591 | "hash": "04badeed083a9d66712fcc286d31092d", | 591 | "hash": "04badeed083a9d66712fcc286d31092d", | ||
592 | "header_row": "", | 592 | "header_row": "", | ||
593 | "id": "121fbbc0-d5cc-4ac2-ad41-e9f00e2eba47", | 593 | "id": "121fbbc0-d5cc-4ac2-ad41-e9f00e2eba47", | ||
594 | "last_modified": "2021-11-23T23:35:04.581894", | 594 | "last_modified": "2021-11-23T23:35:04.581894", | ||
595 | "load_status": "", | 595 | "load_status": "", | ||
596 | "metadata_modified": "2022-05-12T15:13:30.023730", | 596 | "metadata_modified": "2022-05-12T15:13:30.023730", | ||
597 | "mimetype": "application/pdf", | 597 | "mimetype": "application/pdf", | ||
598 | "mimetype_inner": null, | 598 | "mimetype_inner": null, | ||
599 | "name": "Water Quality Monitoring Report 2009 \u2013 2012", | 599 | "name": "Water Quality Monitoring Report 2009 \u2013 2012", | ||
600 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 600 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
601 | "position": 10, | 601 | "position": 10, | ||
602 | "resource_citation": "McPherson, S., K. Kuchapski, and R. | 602 | "resource_citation": "McPherson, S., K. Kuchapski, and R. | ||
603 | MacDonald. 2014. Windermere Creek 2009-2012, water quality monitoring | 603 | MacDonald. 2014. Windermere Creek 2009-2012, water quality monitoring | ||
604 | report. A Columbia Basin Water Quality Monitoring Project. Prepared by | 604 | report. A Columbia Basin Water Quality Monitoring Project. Prepared by | ||
605 | Lotic Environmental Ltd. for Wildsight. [Resource} | 605 | Lotic Environmental Ltd. for Wildsight. [Resource} | ||
606 | https://doi.org/10.48511/KBGB-DJ25", | 606 | https://doi.org/10.48511/KBGB-DJ25", | ||
607 | "resource_data_disclaimer": "No warranty or guarantee exists | 607 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
608 | that the information is accurate, complete, current, or suitable for | 608 | that the information is accurate, complete, current, or suitable for | ||
609 | any purpose. The individual user must confirm the accuracy of the data | 609 | any purpose. The individual user must confirm the accuracy of the data | ||
610 | and whether it will be appropriate for their purpose.", | 610 | and whether it will be appropriate for their purpose.", | ||
611 | "resource_location": "Windermere Creek", | 611 | "resource_location": "Windermere Creek", | ||
612 | "resource_type": null, | 612 | "resource_type": null, | ||
613 | "size": 1166753, | 613 | "size": 1166753, | ||
614 | "state": "active", | 614 | "state": "active", | ||
615 | "url": | 615 | "url": | ||
616 | ntal_report_windermerecreekwaterqualitymonitoringreport2009_2012.pdf", | 616 | ntal_report_windermerecreekwaterqualitymonitoringreport2009_2012.pdf", | ||
617 | "url_type": "upload", | 617 | "url_type": "upload", | ||
618 | "waterhub_certified": "Certified", | 618 | "waterhub_certified": "Certified", | ||
619 | "waterhub_grade": "People and Perspectives" | 619 | "waterhub_grade": "People and Perspectives" | ||
620 | }, | 620 | }, | ||
621 | { | 621 | { | ||
622 | "cache_last_updated": null, | 622 | "cache_last_updated": null, | ||
623 | "cache_url": null, | 623 | "cache_url": null, | ||
624 | "created": "2021-11-23T21:47:42.044031", | 624 | "created": "2021-11-23T21:47:42.044031", | ||
625 | "data_collection_info": "n/a", | 625 | "data_collection_info": "n/a", | ||
626 | "data_processing": "n/a", | 626 | "data_processing": "n/a", | ||
627 | "datastore_active": false, | 627 | "datastore_active": false, | ||
628 | "datastore_status": "", | 628 | "datastore_status": "", | ||
629 | "description": "Data and information included in this report is | 629 | "description": "Data and information included in this report is | ||
630 | a first and preliminary examination of results from Windermere Creek | 630 | a first and preliminary examination of results from Windermere Creek | ||
631 | (BC), which consists of a list of the macroinvertebrate taxa detected | 631 | (BC), which consists of a list of the macroinvertebrate taxa detected | ||
632 | within the samples submitted. This report aims to highlight the | 632 | within the samples submitted. This report aims to highlight the | ||
633 | different macroinvertebrate EPT taxa and provide basic richness | 633 | different macroinvertebrate EPT taxa and provide basic richness | ||
634 | metrics as a useful contribution for community groups to assess river | 634 | metrics as a useful contribution for community groups to assess river | ||
635 | health.", | 635 | health.", | ||
636 | "format": "PDF", | 636 | "format": "PDF", | ||
637 | "hash": "5a1afd2f11385df53ebcddc0131d43f9", | 637 | "hash": "5a1afd2f11385df53ebcddc0131d43f9", | ||
638 | "header_row": "", | 638 | "header_row": "", | ||
639 | "id": "04d7f4c8-f731-4980-aa59-8c8a1a0db5bf", | 639 | "id": "04d7f4c8-f731-4980-aa59-8c8a1a0db5bf", | ||
640 | "last_modified": "2021-11-23T21:47:41.981461", | 640 | "last_modified": "2021-11-23T21:47:41.981461", | ||
641 | "load_status": "Invalid header row: ", | 641 | "load_status": "Invalid header row: ", | ||
642 | "metadata_modified": "2022-05-12T14:51:20.536884", | 642 | "metadata_modified": "2022-05-12T14:51:20.536884", | ||
643 | "mimetype": "application/pdf", | 643 | "mimetype": "application/pdf", | ||
644 | "mimetype_inner": null, | 644 | "mimetype_inner": null, | ||
645 | "name": "Preliminary DNA Data Windermere Creek, BC Columbia | 645 | "name": "Preliminary DNA Data Windermere Creek, BC Columbia | ||
646 | Basin Water Quality Monitoring Project - Windermere Creek", | 646 | Basin Water Quality Monitoring Project - Windermere Creek", | ||
647 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 647 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
648 | "position": 11, | 648 | "position": 11, | ||
649 | "resource_citation": "Lake Windermere Ambassadors. (2019). | 649 | "resource_citation": "Lake Windermere Ambassadors. (2019). | ||
650 | Preliminary DNA Data Windermere Creek, BC Columbia Basin Water Quality | 650 | Preliminary DNA Data Windermere Creek, BC Columbia Basin Water Quality | ||
651 | Monitoring Project - Windermere Creek. Prepared for WWF Canada, | 651 | Monitoring Project - Windermere Creek. Prepared for WWF Canada, | ||
652 | Environment and Climate Change Canada, Living Lakes Canada. Columbia | 652 | Environment and Climate Change Canada, Living Lakes Canada. Columbia | ||
653 | Basin Water Hub [Resource]. Invermere. | 653 | Basin Water Hub [Resource]. Invermere. | ||
654 | https://doi.org/10.48511/KBGB-DJ25", | 654 | https://doi.org/10.48511/KBGB-DJ25", | ||
655 | "resource_data_disclaimer": "No warranty or guarantee exists | 655 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
656 | that the information is accurate, complete, current, or suitable for | 656 | that the information is accurate, complete, current, or suitable for | ||
657 | any purpose. The individual user must confirm the accuracy of the data | 657 | any purpose. The individual user must confirm the accuracy of the data | ||
658 | and whether it will be appropriate for their purpose.", | 658 | and whether it will be appropriate for their purpose.", | ||
659 | "resource_location": "Windermere Creek", | 659 | "resource_location": "Windermere Creek", | ||
660 | "resource_type": null, | 660 | "resource_type": null, | ||
661 | "size": 408000, | 661 | "size": 408000, | ||
662 | "state": "active", | 662 | "state": "active", | ||
663 | "url": | 663 | "url": | ||
664 | ermere-ambassadors_report_preliminarydnadatawindermerecreek_2019.pdf", | 664 | ermere-ambassadors_report_preliminarydnadatawindermerecreek_2019.pdf", | ||
665 | "url_type": "upload", | 665 | "url_type": "upload", | ||
666 | "waterhub_certified": "Certified", | 666 | "waterhub_certified": "Certified", | ||
667 | "waterhub_grade": "People and Perspectives" | 667 | "waterhub_grade": "People and Perspectives" | ||
668 | }, | 668 | }, | ||
669 | { | 669 | { | ||
670 | "cache_last_updated": null, | 670 | "cache_last_updated": null, | ||
671 | "cache_url": null, | 671 | "cache_url": null, | ||
672 | "created": "2021-11-23T22:10:12.978806", | 672 | "created": "2021-11-23T22:10:12.978806", | ||
673 | "data_collection_info": "n/a", | 673 | "data_collection_info": "n/a", | ||
674 | "data_processing": "n/a", | 674 | "data_processing": "n/a", | ||
675 | "datastore_active": false, | 675 | "datastore_active": false, | ||
676 | "datastore_status": "", | 676 | "datastore_status": "", | ||
677 | "description": "No aquatic invasive plant species were detected | 677 | "description": "No aquatic invasive plant species were detected | ||
678 | during shoreline surveys. There was a notable lack of aquatic plants | 678 | during shoreline surveys. There was a notable lack of aquatic plants | ||
679 | detected at the following survey stations: Baltac Beach, End of Ruault | 679 | detected at the following survey stations: Baltac Beach, End of Ruault | ||
680 | Rd, and Unofficial boat launch near Bayshore Condos.\r\n\r\nNo aquatic | 680 | Rd, and Unofficial boat launch near Bayshore Condos.\r\n\r\nNo aquatic | ||
681 | invasive plant species were detected during offshore surveys. As with | 681 | invasive plant species were detected during offshore surveys. As with | ||
682 | previous years of survey effort, dense areas or beds of indigenous | 682 | previous years of survey effort, dense areas or beds of indigenous | ||
683 | aquatic plants were observed in specific locations such as Ruault Road | 683 | aquatic plants were observed in specific locations such as Ruault Road | ||
684 | and Althalmer/Pete\u2019s Marina (Figure 1). There were some survey | 684 | and Althalmer/Pete\u2019s Marina (Figure 1). There were some survey | ||
685 | stations that were essentially devoid of aquatic plant communities, | 685 | stations that were essentially devoid of aquatic plant communities, | ||
686 | such as Baltac Beach, Unofficial boat launch near Bayshore Condos, and | 686 | such as Baltac Beach, Unofficial boat launch near Bayshore Condos, and | ||
687 | Tretheway Docks.", | 687 | Tretheway Docks.", | ||
688 | "format": "PDF", | 688 | "format": "PDF", | ||
689 | "hash": "6a3f5d12b394b13926e9fbb7552b66fa", | 689 | "hash": "6a3f5d12b394b13926e9fbb7552b66fa", | ||
690 | "header_row": "", | 690 | "header_row": "", | ||
691 | "id": "141a882d-dcb3-4ff2-bd42-3ee3fb580f0e", | 691 | "id": "141a882d-dcb3-4ff2-bd42-3ee3fb580f0e", | ||
692 | "last_modified": "2021-11-23T22:10:12.915634", | 692 | "last_modified": "2021-11-23T22:10:12.915634", | ||
693 | "load_status": "", | 693 | "load_status": "", | ||
694 | "metadata_modified": "2022-05-12T15:14:45.547914", | 694 | "metadata_modified": "2022-05-12T15:14:45.547914", | ||
695 | "mimetype": "application/pdf", | 695 | "mimetype": "application/pdf", | ||
696 | "mimetype_inner": null, | 696 | "mimetype_inner": null, | ||
697 | "name": "Aquatic Invasive Plant Species Inventory 2019", | 697 | "name": "Aquatic Invasive Plant Species Inventory 2019", | ||
698 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 698 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
699 | "position": 12, | 699 | "position": 12, | ||
700 | "resource_citation": "Darvill. (2019). Lake Windermere Aquatic | 700 | "resource_citation": "Darvill. (2019). Lake Windermere Aquatic | ||
701 | Invasive Plant Species Inventory 2019. Prepared for Lake Windermere | 701 | Invasive Plant Species Inventory 2019. Prepared for Lake Windermere | ||
702 | Ambassadors. Columbia Basin Water Hub [Resource].\u00a0Parson. | 702 | Ambassadors. Columbia Basin Water Hub [Resource].\u00a0Parson. | ||
703 | https://doi.org/10.48511/KBGB-DJ25", | 703 | https://doi.org/10.48511/KBGB-DJ25", | ||
704 | "resource_data_disclaimer": "No warranty or guarantee exists | 704 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
705 | that the information is accurate, complete, current, or suitable for | 705 | that the information is accurate, complete, current, or suitable for | ||
706 | any purpose. The individual user must confirm the accuracy of the data | 706 | any purpose. The individual user must confirm the accuracy of the data | ||
707 | and whether it will be appropriate for their purpose.", | 707 | and whether it will be appropriate for their purpose.", | ||
708 | "resource_location": "Lake Windermere", | 708 | "resource_location": "Lake Windermere", | ||
709 | "resource_type": null, | 709 | "resource_type": null, | ||
710 | "size": 1454992, | 710 | "size": 1454992, | ||
711 | "state": "active", | 711 | "state": "active", | ||
712 | "url": | 712 | "url": | ||
713 | _report_lakewindermereaquaticinvasiveplantspecies-inventory_2019.pdf", | 713 | _report_lakewindermereaquaticinvasiveplantspecies-inventory_2019.pdf", | ||
714 | "url_type": "upload", | 714 | "url_type": "upload", | ||
715 | "waterhub_certified": "Certified", | 715 | "waterhub_certified": "Certified", | ||
716 | "waterhub_grade": "People and Perspectives" | 716 | "waterhub_grade": "People and Perspectives" | ||
717 | }, | 717 | }, | ||
718 | { | 718 | { | ||
719 | "cache_last_updated": null, | 719 | "cache_last_updated": null, | ||
720 | "cache_url": null, | 720 | "cache_url": null, | ||
721 | "created": "2021-11-23T22:31:35.205581", | 721 | "created": "2021-11-23T22:31:35.205581", | ||
722 | "data_collection_info": "n/a", | 722 | "data_collection_info": "n/a", | ||
723 | "data_processing": "n/a", | 723 | "data_processing": "n/a", | ||
724 | "datastore_active": false, | 724 | "datastore_active": false, | ||
n | n | 725 | "datastore_status": "", | ||
725 | "description": "No aquatic invasive plant species were detected | 726 | "description": "No aquatic invasive plant species were detected | ||
726 | during shoreline surveys. Aquatic invasive plant species detection is | 727 | during shoreline surveys. Aquatic invasive plant species detection is | ||
727 | the primary focus on this study. However, all native plant species | 728 | the primary focus on this study. However, all native plant species | ||
728 | that were collected through rake pulls are listed in Appendix 1. | 729 | that were collected through rake pulls are listed in Appendix 1. | ||
729 | \r\n\r\nAll offshore sampling resulted in no aquatic invasive plant | 730 | \r\n\r\nAll offshore sampling resulted in no aquatic invasive plant | ||
730 | species being detected. As with previous years of survey effort, dense | 731 | species being detected. As with previous years of survey effort, dense | ||
731 | areas of native aquatic plants were observed in locations such as | 732 | areas of native aquatic plants were observed in locations such as | ||
732 | Ruault Road and Althalmer/Pete\u2019s Marina. While aquatic invasive | 733 | Ruault Road and Althalmer/Pete\u2019s Marina. While aquatic invasive | ||
733 | plant detection was the primary focus of this study, all native | 734 | plant detection was the primary focus of this study, all native | ||
734 | aquatic plants were identified to the species level where possible, | 735 | aquatic plants were identified to the species level where possible, | ||
735 | and are listed in Appendix 2.", | 736 | and are listed in Appendix 2.", | ||
736 | "format": "PDF", | 737 | "format": "PDF", | ||
737 | "hash": "97d2fed2747971fb1bd9e1bc07637600", | 738 | "hash": "97d2fed2747971fb1bd9e1bc07637600", | ||
738 | "header_row": "", | 739 | "header_row": "", | ||
739 | "id": "bff727d2-e463-4a01-9c21-768180cbb0f5", | 740 | "id": "bff727d2-e463-4a01-9c21-768180cbb0f5", | ||
740 | "last_modified": "2021-11-23T22:31:35.136576", | 741 | "last_modified": "2021-11-23T22:31:35.136576", | ||
n | 741 | "metadata_modified": "2021-11-23T22:31:35.205581", | n | 742 | "load_status": "", |
743 | "metadata_modified": "2022-05-12T15:16:06.658315", | ||||
742 | "mimetype": "application/pdf", | 744 | "mimetype": "application/pdf", | ||
743 | "mimetype_inner": null, | 745 | "mimetype_inner": null, | ||
744 | "name": "Aquatic Invasive Plant Species Inventory 2018", | 746 | "name": "Aquatic Invasive Plant Species Inventory 2018", | ||
745 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 747 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
746 | "position": 13, | 748 | "position": 13, | ||
n | 747 | "resource_citation": "Darvill (2018). Lake Windermere Aquatic | n | 749 | "resource_citation": "Darvill. (2018). Lake Windermere Aquatic |
748 | Invasive Plant Species Inventory 2018. Prepared for Lake Windermere | 750 | Invasive Plant Species Inventory 2018. Prepared for Lake Windermere | ||
t | 749 | Ambassadors. Columbia Basin Water Hub (Resource).\u00a0 Parson. | t | 751 | Ambassadors. Columbia Basin Water Hub [Resource].\u00a0 Parson. |
750 | (DOI)", | 752 | https://doi.org/10.48511/KBGB-DJ25", | ||
751 | "resource_data_disclaimer": "No warranty or guarantee exists | 753 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
752 | that the information is accurate, complete, current, or suitable for | 754 | that the information is accurate, complete, current, or suitable for | ||
753 | any purpose. The individual user must confirm the accuracy of the data | 755 | any purpose. The individual user must confirm the accuracy of the data | ||
754 | and whether it will be appropriate for their purpose.", | 756 | and whether it will be appropriate for their purpose.", | ||
755 | "resource_location": "Lake Windermere", | 757 | "resource_location": "Lake Windermere", | ||
756 | "resource_type": null, | 758 | "resource_type": null, | ||
757 | "size": 1354021, | 759 | "size": 1354021, | ||
758 | "state": "active", | 760 | "state": "active", | ||
759 | "url": | 761 | "url": | ||
760 | darvill_report_lakewindermereaquaticinvasiveplantsinventory_2018.pdf", | 762 | darvill_report_lakewindermereaquaticinvasiveplantsinventory_2018.pdf", | ||
761 | "url_type": "upload", | 763 | "url_type": "upload", | ||
762 | "waterhub_certified": "Certified", | 764 | "waterhub_certified": "Certified", | ||
763 | "waterhub_grade": "People and Perspectives" | 765 | "waterhub_grade": "People and Perspectives" | ||
764 | }, | 766 | }, | ||
765 | { | 767 | { | ||
766 | "cache_last_updated": null, | 768 | "cache_last_updated": null, | ||
767 | "cache_url": null, | 769 | "cache_url": null, | ||
768 | "created": "2021-11-23T22:44:38.629271", | 770 | "created": "2021-11-23T22:44:38.629271", | ||
769 | "data_collection_info": "n/a", | 771 | "data_collection_info": "n/a", | ||
770 | "data_processing": "n/a", | 772 | "data_processing": "n/a", | ||
771 | "datastore_active": false, | 773 | "datastore_active": false, | ||
772 | "description": "No aquatic invasive plant species were detected | 774 | "description": "No aquatic invasive plant species were detected | ||
773 | during the shoreline surveys. Aquatic invasive plant species detection | 775 | during the shoreline surveys. Aquatic invasive plant species detection | ||
774 | is the primary focus on this study; however, all native plant species | 776 | is the primary focus on this study; however, all native plant species | ||
775 | that were collected through rake pulls are listed in Appendix 1. | 777 | that were collected through rake pulls are listed in Appendix 1. | ||
776 | \r\n\r\nAll offshore sampling resulted in the detection of no aquatic | 778 | \r\n\r\nAll offshore sampling resulted in the detection of no aquatic | ||
777 | invasive plant species. Multiple beds of dense native aquatic plants | 779 | invasive plant species. Multiple beds of dense native aquatic plants | ||
778 | were located in locations such as Ruault Road and | 780 | were located in locations such as Ruault Road and | ||
779 | Althalmer/Pete\u2019s Marina. While aquatic invasive plant detection | 781 | Althalmer/Pete\u2019s Marina. While aquatic invasive plant detection | ||
780 | was the primary focus of this study, all native aquatic plants were | 782 | was the primary focus of this study, all native aquatic plants were | ||
781 | identified to the species level where possible, and are listed in | 783 | identified to the species level where possible, and are listed in | ||
782 | Appendix 2.\r\n\r\nAll veliger samples submitted by the EKISP to the | 784 | Appendix 2.\r\n\r\nAll veliger samples submitted by the EKISP to the | ||
783 | appropriate laboratory were reported back to the EKISC as negative. | 785 | appropriate laboratory were reported back to the EKISC as negative. | ||
784 | This indicates that no invasive mussel (Zebra Mussel (Dreissena | 786 | This indicates that no invasive mussel (Zebra Mussel (Dreissena | ||
785 | polymorph)/Quagga Mussel (Dreissena bugensis) veligers were identified | 787 | polymorph)/Quagga Mussel (Dreissena bugensis) veligers were identified | ||
786 | by the laboratory that analyzed the samples.", | 788 | by the laboratory that analyzed the samples.", | ||
787 | "format": "PDF", | 789 | "format": "PDF", | ||
788 | "hash": "2cc5a8ceb551df27d99f5f9718a11f46", | 790 | "hash": "2cc5a8ceb551df27d99f5f9718a11f46", | ||
789 | "header_row": "", | 791 | "header_row": "", | ||
790 | "id": "8cebdc8d-85ed-4c17-941e-3c50e4d84cd4", | 792 | "id": "8cebdc8d-85ed-4c17-941e-3c50e4d84cd4", | ||
791 | "last_modified": "2021-11-23T22:44:38.559073", | 793 | "last_modified": "2021-11-23T22:44:38.559073", | ||
792 | "metadata_modified": "2021-11-23T22:44:38.629271", | 794 | "metadata_modified": "2021-11-23T22:44:38.629271", | ||
793 | "mimetype": "application/pdf", | 795 | "mimetype": "application/pdf", | ||
794 | "mimetype_inner": null, | 796 | "mimetype_inner": null, | ||
795 | "name": "Aquatic Invasive Species Inventory 2017", | 797 | "name": "Aquatic Invasive Species Inventory 2017", | ||
796 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 798 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
797 | "position": 14, | 799 | "position": 14, | ||
798 | "resource_citation": "Darvill (2017). Lake Windermere Aquatic | 800 | "resource_citation": "Darvill (2017). Lake Windermere Aquatic | ||
799 | Invasive Species Inventory 2017. Prepared for Lake Windermere | 801 | Invasive Species Inventory 2017. Prepared for Lake Windermere | ||
800 | Ambassadors. Columbia Basin Water Hub (Resource).\u00a0Parson. | 802 | Ambassadors. Columbia Basin Water Hub (Resource).\u00a0Parson. | ||
801 | (DOI)\u2028", | 803 | (DOI)\u2028", | ||
802 | "resource_data_disclaimer": "No warranty or guarantee exists | 804 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
803 | that the information is accurate, complete, current, or suitable for | 805 | that the information is accurate, complete, current, or suitable for | ||
804 | any purpose. The individual user must confirm the accuracy of the data | 806 | any purpose. The individual user must confirm the accuracy of the data | ||
805 | and whether it will be appropriate for their purpose.", | 807 | and whether it will be appropriate for their purpose.", | ||
806 | "resource_location": "Lake Windermere", | 808 | "resource_location": "Lake Windermere", | ||
807 | "resource_type": null, | 809 | "resource_type": null, | ||
808 | "size": 1501477, | 810 | "size": 1501477, | ||
809 | "state": "active", | 811 | "state": "active", | ||
810 | "url": | 812 | "url": | ||
811 | darvill_report_lakewindermereaquaticinvasiveplantsinventory_2017.pdf", | 813 | darvill_report_lakewindermereaquaticinvasiveplantsinventory_2017.pdf", | ||
812 | "url_type": "upload", | 814 | "url_type": "upload", | ||
813 | "waterhub_certified": "Certified", | 815 | "waterhub_certified": "Certified", | ||
814 | "waterhub_grade": "People and Perspectives" | 816 | "waterhub_grade": "People and Perspectives" | ||
815 | }, | 817 | }, | ||
816 | { | 818 | { | ||
817 | "cache_last_updated": null, | 819 | "cache_last_updated": null, | ||
818 | "cache_url": null, | 820 | "cache_url": null, | ||
819 | "created": "2021-11-23T22:57:01.513020", | 821 | "created": "2021-11-23T22:57:01.513020", | ||
820 | "data_collection_info": "n/a", | 822 | "data_collection_info": "n/a", | ||
821 | "data_processing": "n/a", | 823 | "data_processing": "n/a", | ||
822 | "datastore_active": false, | 824 | "datastore_active": false, | ||
823 | "description": "The purpose of conducting AIS monitoring on Lake | 825 | "description": "The purpose of conducting AIS monitoring on Lake | ||
824 | Windermere in 2016 is to sample both offshore and onshore locations | 826 | Windermere in 2016 is to sample both offshore and onshore locations | ||
825 | for AIS such as Eurasian Watermilfoil (Myriophyllum spicatum), | 827 | for AIS such as Eurasian Watermilfoil (Myriophyllum spicatum), | ||
826 | Curyleaf Pondweed (Potamogeton crispu), Zebra Mussel (Dreissena | 828 | Curyleaf Pondweed (Potamogeton crispu), Zebra Mussel (Dreissena | ||
827 | polymorph) and Quagga Mussel (Dreissena bugensis). Continuing to | 829 | polymorph) and Quagga Mussel (Dreissena bugensis). Continuing to | ||
828 | sample for AIS on an annual basis on Lake Windermere will facilitate a | 830 | sample for AIS on an annual basis on Lake Windermere will facilitate a | ||
829 | rapid response for any detected species within this high risk lake | 831 | rapid response for any detected species within this high risk lake | ||
830 | ecosystem.", | 832 | ecosystem.", | ||
831 | "format": "PDF", | 833 | "format": "PDF", | ||
832 | "hash": "0e9235356278419204fd47722949065b", | 834 | "hash": "0e9235356278419204fd47722949065b", | ||
833 | "header_row": "", | 835 | "header_row": "", | ||
834 | "id": "cf49cf49-5e4a-494a-bb7f-5fd57fc88c02", | 836 | "id": "cf49cf49-5e4a-494a-bb7f-5fd57fc88c02", | ||
835 | "last_modified": "2021-11-23T22:57:01.438585", | 837 | "last_modified": "2021-11-23T22:57:01.438585", | ||
836 | "metadata_modified": "2021-11-23T22:57:01.513020", | 838 | "metadata_modified": "2021-11-23T22:57:01.513020", | ||
837 | "mimetype": "application/pdf", | 839 | "mimetype": "application/pdf", | ||
838 | "mimetype_inner": null, | 840 | "mimetype_inner": null, | ||
839 | "name": "Aquatic Invasive Species Sampling 2016", | 841 | "name": "Aquatic Invasive Species Sampling 2016", | ||
840 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 842 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
841 | "position": 15, | 843 | "position": 15, | ||
842 | "resource_citation": "Darvill (2016). Lake Windermere Aquatic | 844 | "resource_citation": "Darvill (2016). Lake Windermere Aquatic | ||
843 | Invasive Species Sampling 2016. Prepared for Lake Windermere | 845 | Invasive Species Sampling 2016. Prepared for Lake Windermere | ||
844 | Ambassadors. Columbia Basin Water Hub (Resource).\u00a0Parson. | 846 | Ambassadors. Columbia Basin Water Hub (Resource).\u00a0Parson. | ||
845 | (DOI)\u2028", | 847 | (DOI)\u2028", | ||
846 | "resource_data_disclaimer": "No warranty or guarantee exists | 848 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
847 | that the information is accurate, complete, current, or suitable for | 849 | that the information is accurate, complete, current, or suitable for | ||
848 | any purpose. The individual user must confirm the accuracy of the data | 850 | any purpose. The individual user must confirm the accuracy of the data | ||
849 | and whether it will be appropriate for their purpose.", | 851 | and whether it will be appropriate for their purpose.", | ||
850 | "resource_location": "Lake Windermere", | 852 | "resource_location": "Lake Windermere", | ||
851 | "resource_type": null, | 853 | "resource_type": null, | ||
852 | "size": 1528687, | 854 | "size": 1528687, | ||
853 | "state": "active", | 855 | "state": "active", | ||
854 | "url": | 856 | "url": | ||
855 | darvill_report_lakewindermereaquaticinvasiveplantsinventory_2016.pdf", | 857 | darvill_report_lakewindermereaquaticinvasiveplantsinventory_2016.pdf", | ||
856 | "url_type": "upload", | 858 | "url_type": "upload", | ||
857 | "waterhub_certified": "Certified", | 859 | "waterhub_certified": "Certified", | ||
858 | "waterhub_grade": "People and Perspectives" | 860 | "waterhub_grade": "People and Perspectives" | ||
859 | }, | 861 | }, | ||
860 | { | 862 | { | ||
861 | "cache_last_updated": null, | 863 | "cache_last_updated": null, | ||
862 | "cache_url": null, | 864 | "cache_url": null, | ||
863 | "created": "2021-11-23T23:10:09.741094", | 865 | "created": "2021-11-23T23:10:09.741094", | ||
864 | "data_collection_info": "n/a", | 866 | "data_collection_info": "n/a", | ||
865 | "data_processing": "n/a", | 867 | "data_processing": "n/a", | ||
866 | "datastore_active": false, | 868 | "datastore_active": false, | ||
867 | "description": "This year (2015) marked the sixth successive | 869 | "description": "This year (2015) marked the sixth successive | ||
868 | year (with the exception of 2013) where aquatic plants were sampled | 870 | year (with the exception of 2013) where aquatic plants were sampled | ||
869 | along multiple locations along the Lake Windermere shoreline. This | 871 | along multiple locations along the Lake Windermere shoreline. This | ||
870 | year also saw the first year of AIS sampling from a boat at offshore | 872 | year also saw the first year of AIS sampling from a boat at offshore | ||
871 | locations, including veliger sampling for invasive mussels (quagga and | 873 | locations, including veliger sampling for invasive mussels (quagga and | ||
872 | zebra).", | 874 | zebra).", | ||
873 | "format": "PDF", | 875 | "format": "PDF", | ||
874 | "hash": "c905077c6c7766a76ded7f930dc0f8ee", | 876 | "hash": "c905077c6c7766a76ded7f930dc0f8ee", | ||
875 | "header_row": "", | 877 | "header_row": "", | ||
876 | "id": "c52fe1c4-6791-4ac0-b1b8-5aa8123829f2", | 878 | "id": "c52fe1c4-6791-4ac0-b1b8-5aa8123829f2", | ||
877 | "last_modified": "2021-11-23T23:10:09.658955", | 879 | "last_modified": "2021-11-23T23:10:09.658955", | ||
878 | "metadata_modified": "2021-11-23T23:10:09.741094", | 880 | "metadata_modified": "2021-11-23T23:10:09.741094", | ||
879 | "mimetype": "application/pdf", | 881 | "mimetype": "application/pdf", | ||
880 | "mimetype_inner": null, | 882 | "mimetype_inner": null, | ||
881 | "name": "Aquatic Invasive Plant Sampling 2015", | 883 | "name": "Aquatic Invasive Plant Sampling 2015", | ||
882 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 884 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
883 | "position": 16, | 885 | "position": 16, | ||
884 | "resource_citation": "Darvill (2015). Lake Windermere Aquatic | 886 | "resource_citation": "Darvill (2015). Lake Windermere Aquatic | ||
885 | Invasive Plant Sampling 2015. Prepared for Lake Windermere | 887 | Invasive Plant Sampling 2015. Prepared for Lake Windermere | ||
886 | Ambassadors. Columbia Basin Water Hub (Resource).\u00a0Parson. | 888 | Ambassadors. Columbia Basin Water Hub (Resource).\u00a0Parson. | ||
887 | (DOI)\u2028", | 889 | (DOI)\u2028", | ||
888 | "resource_data_disclaimer": "No warranty or guarantee exists | 890 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
889 | that the information is accurate, complete, current, or suitable for | 891 | that the information is accurate, complete, current, or suitable for | ||
890 | any purpose. The individual user must confirm the accuracy of the data | 892 | any purpose. The individual user must confirm the accuracy of the data | ||
891 | and whether it will be appropriate for their purpose.", | 893 | and whether it will be appropriate for their purpose.", | ||
892 | "resource_location": "Lake Windermere", | 894 | "resource_location": "Lake Windermere", | ||
893 | "resource_type": null, | 895 | "resource_type": null, | ||
894 | "size": 894650, | 896 | "size": 894650, | ||
895 | "state": "active", | 897 | "state": "active", | ||
896 | "url": | 898 | "url": | ||
897 | darvill_report_lakewindermereaquaticinvasiveplantsinventory_2015.pdf", | 899 | darvill_report_lakewindermereaquaticinvasiveplantsinventory_2015.pdf", | ||
898 | "url_type": "upload", | 900 | "url_type": "upload", | ||
899 | "waterhub_certified": "Certified", | 901 | "waterhub_certified": "Certified", | ||
900 | "waterhub_grade": "People and Perspectives" | 902 | "waterhub_grade": "People and Perspectives" | ||
901 | }, | 903 | }, | ||
902 | { | 904 | { | ||
903 | "cache_last_updated": null, | 905 | "cache_last_updated": null, | ||
904 | "cache_url": null, | 906 | "cache_url": null, | ||
905 | "created": "2021-11-23T22:17:28.963537", | 907 | "created": "2021-11-23T22:17:28.963537", | ||
906 | "data_collection_info": "n/a", | 908 | "data_collection_info": "n/a", | ||
907 | "data_processing": "n/a", | 909 | "data_processing": "n/a", | ||
908 | "datastore_active": false, | 910 | "datastore_active": false, | ||
909 | "description": "The main purpose of this paper is to provide | 911 | "description": "The main purpose of this paper is to provide | ||
910 | information for what is currently known about the waterbird species | 912 | information for what is currently known about the waterbird species | ||
911 | that utilize Lake Windermere habitat. This report will provide the | 913 | that utilize Lake Windermere habitat. This report will provide the | ||
912 | findings of a single-day bird count conducted on the northern half of | 914 | findings of a single-day bird count conducted on the northern half of | ||
913 | Lake Windermere in September 2018. Lake Windermere bird data retrieved | 915 | Lake Windermere in September 2018. Lake Windermere bird data retrieved | ||
914 | from an online database (eBird) was reviewed and indicates that 165 | 916 | from an online database (eBird) was reviewed and indicates that 165 | ||
915 | bird species have been detected at Lake Windermere, 17 of these | 917 | bird species have been detected at Lake Windermere, 17 of these | ||
916 | species are considered to be at-risk. A review of historic and more | 918 | species are considered to be at-risk. A review of historic and more | ||
917 | recent bird data indicates that Lake Windermere contains important | 919 | recent bird data indicates that Lake Windermere contains important | ||
918 | bird habitat. The south end of the lake consistently has large | 920 | bird habitat. The south end of the lake consistently has large | ||
919 | concentrations of staging waterfowl during migration, and has the | 921 | concentrations of staging waterfowl during migration, and has the | ||
920 | highest single day bird counts resulting from a regional coordinated | 922 | highest single day bird counts resulting from a regional coordinated | ||
921 | bird count (i.e. Columbia Wetlands Waterbird Survey). When compared | 923 | bird count (i.e. Columbia Wetlands Waterbird Survey). When compared | ||
922 | across 105 survey stations in the Columbia Wetlands, the south end of | 924 | across 105 survey stations in the Columbia Wetlands, the south end of | ||
923 | Lake Windermere appears to contain the most important staging area | 925 | Lake Windermere appears to contain the most important staging area | ||
924 | within the continuous wetlands ecosystem for at-risk grebe species, as | 926 | within the continuous wetlands ecosystem for at-risk grebe species, as | ||
925 | well as for other bird species such as American coot. Creek mouths | 927 | well as for other bird species such as American coot. Creek mouths | ||
926 | found at Lake Windermere are also important habitat for birds, | 928 | found at Lake Windermere are also important habitat for birds, | ||
927 | especially for migrating shorebirds. Information on why birds are | 929 | especially for migrating shorebirds. Information on why birds are | ||
928 | important will be presented here, as well as a brief overview on the | 930 | important will be presented here, as well as a brief overview on the | ||
929 | decline of more than one-third of the world\u2019s bird populations. | 931 | decline of more than one-third of the world\u2019s bird populations. | ||
930 | Several suggestions for future action will be provided that may help | 932 | Several suggestions for future action will be provided that may help | ||
931 | to ensure that Lake Windermere continues to provide important habitat | 933 | to ensure that Lake Windermere continues to provide important habitat | ||
932 | to birds. These include: a) conducting additional fall bird surveys on | 934 | to birds. These include: a) conducting additional fall bird surveys on | ||
933 | the lake, b) completing spring breeding bird surveys in order to | 935 | the lake, b) completing spring breeding bird surveys in order to | ||
934 | assess the utilization of the lake area during a critical life history | 936 | assess the utilization of the lake area during a critical life history | ||
935 | stage and to identify and conserve key breeding sites, c) minimizing | 937 | stage and to identify and conserve key breeding sites, c) minimizing | ||
936 | boat traffic in and near nesting, staging, feeding areas during | 938 | boat traffic in and near nesting, staging, feeding areas during | ||
937 | specific times of year, d) public education regarding the importance | 939 | specific times of year, d) public education regarding the importance | ||
938 | of Lake Windermere to birds including at-risk species, and e) marking | 940 | of Lake Windermere to birds including at-risk species, and e) marking | ||
939 | the wildlife management area located at the south end of Lake | 941 | the wildlife management area located at the south end of Lake | ||
940 | Windermere with educational buoys alerting all recreational users of | 942 | Windermere with educational buoys alerting all recreational users of | ||
941 | this boundary (i.e. current legal restrictions make this area | 943 | this boundary (i.e. current legal restrictions make this area | ||
942 | off-limits to motorized water craft). Currently, there are fewer | 944 | off-limits to motorized water craft). Currently, there are fewer | ||
943 | significant wetland areas in the world remaining as habitat for birds. | 945 | significant wetland areas in the world remaining as habitat for birds. | ||
944 | These remaining key areas deserve conservation attention and | 946 | These remaining key areas deserve conservation attention and | ||
945 | recognition.", | 947 | recognition.", | ||
946 | "format": "PDF", | 948 | "format": "PDF", | ||
947 | "hash": "bf1420857dd34dceb70ac95a7802df06", | 949 | "hash": "bf1420857dd34dceb70ac95a7802df06", | ||
948 | "header_row": "", | 950 | "header_row": "", | ||
949 | "id": "6871538d-ae61-46cb-b7bb-0c7d8e2a2bc1", | 951 | "id": "6871538d-ae61-46cb-b7bb-0c7d8e2a2bc1", | ||
950 | "last_modified": "2021-11-23T22:17:28.898335", | 952 | "last_modified": "2021-11-23T22:17:28.898335", | ||
951 | "metadata_modified": "2021-11-23T22:17:28.963537", | 953 | "metadata_modified": "2021-11-23T22:17:28.963537", | ||
952 | "mimetype": "application/pdf", | 954 | "mimetype": "application/pdf", | ||
953 | "mimetype_inner": null, | 955 | "mimetype_inner": null, | ||
954 | "name": "Insight into the Waterbirds of Lake Windermere", | 956 | "name": "Insight into the Waterbirds of Lake Windermere", | ||
955 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | 957 | "package_id": "626ba05e-057d-458f-9435-3ae0aa0f94d8", | ||
956 | "position": 17, | 958 | "position": 17, | ||
957 | "resource_citation": "Darvill (2019). Insight into the | 959 | "resource_citation": "Darvill (2019). Insight into the | ||
958 | Waterbirds of Lake Windermere. Prepared for Lake Windermere | 960 | Waterbirds of Lake Windermere. Prepared for Lake Windermere | ||
959 | Ambassadors. Columbia Basin Water Hub (Resource).\u00a0 Parson. | 961 | Ambassadors. Columbia Basin Water Hub (Resource).\u00a0 Parson. | ||
960 | (DOI)", | 962 | (DOI)", | ||
961 | "resource_data_disclaimer": "No warranty or guarantee exists | 963 | "resource_data_disclaimer": "No warranty or guarantee exists | ||
962 | that the information is accurate, complete, current, or suitable for | 964 | that the information is accurate, complete, current, or suitable for | ||
963 | any purpose. The individual user must confirm the accuracy of the data | 965 | any purpose. The individual user must confirm the accuracy of the data | ||
964 | and whether it will be appropriate for their purpose.", | 966 | and whether it will be appropriate for their purpose.", | ||
965 | "resource_location": "Lake Windermere", | 967 | "resource_location": "Lake Windermere", | ||
966 | "resource_type": null, | 968 | "resource_type": null, | ||
967 | "size": 2009958, | 969 | "size": 2009958, | ||
968 | "state": "active", | 970 | "state": "active", | ||
969 | "url": | 971 | "url": | ||
970 | lwa_darvill_report_insightintothewaterbirdsoflakewindermere_2019.pdf", | 972 | lwa_darvill_report_insightintothewaterbirdsoflakewindermere_2019.pdf", | ||
971 | "url_type": "upload", | 973 | "url_type": "upload", | ||
972 | "waterhub_certified": "Certified", | 974 | "waterhub_certified": "Certified", | ||
973 | "waterhub_grade": "People and Perspectives" | 975 | "waterhub_grade": "People and Perspectives" | ||
974 | } | 976 | } | ||
975 | ], | 977 | ], | ||
976 | "start_date": "2009-01-01", | 978 | "start_date": "2009-01-01", | ||
977 | "state": "active", | 979 | "state": "active", | ||
978 | "tags": [ | 980 | "tags": [ | ||
979 | { | 981 | { | ||
980 | "display_name": "Bacteriological", | 982 | "display_name": "Bacteriological", | ||
981 | "id": "b446598e-8ac4-4dce-8eed-3ab2d595aca7", | 983 | "id": "b446598e-8ac4-4dce-8eed-3ab2d595aca7", | ||
982 | "name": "Bacteriological", | 984 | "name": "Bacteriological", | ||
983 | "state": "active", | 985 | "state": "active", | ||
984 | "vocabulary_id": null | 986 | "vocabulary_id": null | ||
985 | }, | 987 | }, | ||
986 | { | 988 | { | ||
987 | "display_name": "CABIN", | 989 | "display_name": "CABIN", | ||
988 | "id": "476e5cf2-3801-40e8-9c73-dac2cedbaf7f", | 990 | "id": "476e5cf2-3801-40e8-9c73-dac2cedbaf7f", | ||
989 | "name": "CABIN", | 991 | "name": "CABIN", | ||
990 | "state": "active", | 992 | "state": "active", | ||
991 | "vocabulary_id": null | 993 | "vocabulary_id": null | ||
992 | }, | 994 | }, | ||
993 | { | 995 | { | ||
994 | "display_name": "Community-based monitoring", | 996 | "display_name": "Community-based monitoring", | ||
995 | "id": "9b75240a-5e54-43c9-9063-969983d065f6", | 997 | "id": "9b75240a-5e54-43c9-9063-969983d065f6", | ||
996 | "name": "Community-based monitoring", | 998 | "name": "Community-based monitoring", | ||
997 | "state": "active", | 999 | "state": "active", | ||
998 | "vocabulary_id": null | 1000 | "vocabulary_id": null | ||
999 | }, | 1001 | }, | ||
1000 | { | 1002 | { | ||
1001 | "display_name": "Fish", | 1003 | "display_name": "Fish", | ||
1002 | "id": "e5dce2fc-ec9c-4a16-83b3-9b1d0f991c12", | 1004 | "id": "e5dce2fc-ec9c-4a16-83b3-9b1d0f991c12", | ||
1003 | "name": "Fish", | 1005 | "name": "Fish", | ||
1004 | "state": "active", | 1006 | "state": "active", | ||
1005 | "vocabulary_id": null | 1007 | "vocabulary_id": null | ||
1006 | }, | 1008 | }, | ||
1007 | { | 1009 | { | ||
1008 | "display_name": "Hydrology", | 1010 | "display_name": "Hydrology", | ||
1009 | "id": "eb52bf78-f171-4c0b-961b-c7a49fed2236", | 1011 | "id": "eb52bf78-f171-4c0b-961b-c7a49fed2236", | ||
1010 | "name": "Hydrology", | 1012 | "name": "Hydrology", | ||
1011 | "state": "active", | 1013 | "state": "active", | ||
1012 | "vocabulary_id": null | 1014 | "vocabulary_id": null | ||
1013 | }, | 1015 | }, | ||
1014 | { | 1016 | { | ||
1015 | "display_name": "Hydrometric", | 1017 | "display_name": "Hydrometric", | ||
1016 | "id": "ae588e2d-8628-4e7f-ad0a-2cbd38adfd76", | 1018 | "id": "ae588e2d-8628-4e7f-ad0a-2cbd38adfd76", | ||
1017 | "name": "Hydrometric", | 1019 | "name": "Hydrometric", | ||
1018 | "state": "active", | 1020 | "state": "active", | ||
1019 | "vocabulary_id": null | 1021 | "vocabulary_id": null | ||
1020 | }, | 1022 | }, | ||
1021 | { | 1023 | { | ||
1022 | "display_name": "Lake", | 1024 | "display_name": "Lake", | ||
1023 | "id": "66dc1292-41ac-45cf-a267-f0d5c8a31826", | 1025 | "id": "66dc1292-41ac-45cf-a267-f0d5c8a31826", | ||
1024 | "name": "Lake", | 1026 | "name": "Lake", | ||
1025 | "state": "active", | 1027 | "state": "active", | ||
1026 | "vocabulary_id": null | 1028 | "vocabulary_id": null | ||
1027 | }, | 1029 | }, | ||
1028 | { | 1030 | { | ||
1029 | "display_name": "People and Perspectives", | 1031 | "display_name": "People and Perspectives", | ||
1030 | "id": "bce02f6f-d09f-4305-8e4e-bfeabaeb3a2c", | 1032 | "id": "bce02f6f-d09f-4305-8e4e-bfeabaeb3a2c", | ||
1031 | "name": "People and Perspectives", | 1033 | "name": "People and Perspectives", | ||
1032 | "state": "active", | 1034 | "state": "active", | ||
1033 | "vocabulary_id": null | 1035 | "vocabulary_id": null | ||
1034 | }, | 1036 | }, | ||
1035 | { | 1037 | { | ||
1036 | "display_name": "Sediment Analysis", | 1038 | "display_name": "Sediment Analysis", | ||
1037 | "id": "7bb5f9ef-401c-4112-8a32-4a31695a3e25", | 1039 | "id": "7bb5f9ef-401c-4112-8a32-4a31695a3e25", | ||
1038 | "name": "Sediment Analysis", | 1040 | "name": "Sediment Analysis", | ||
1039 | "state": "active", | 1041 | "state": "active", | ||
1040 | "vocabulary_id": null | 1042 | "vocabulary_id": null | ||
1041 | }, | 1043 | }, | ||
1042 | { | 1044 | { | ||
1043 | "display_name": "Stream", | 1045 | "display_name": "Stream", | ||
1044 | "id": "208421f0-ebb5-4b32-8111-2ff156803d73", | 1046 | "id": "208421f0-ebb5-4b32-8111-2ff156803d73", | ||
1045 | "name": "Stream", | 1047 | "name": "Stream", | ||
1046 | "state": "active", | 1048 | "state": "active", | ||
1047 | "vocabulary_id": null | 1049 | "vocabulary_id": null | ||
1048 | }, | 1050 | }, | ||
1049 | { | 1051 | { | ||
1050 | "display_name": "Water Quality", | 1052 | "display_name": "Water Quality", | ||
1051 | "id": "12fe3ab5-fdaf-44c5-8167-06c7589d90f3", | 1053 | "id": "12fe3ab5-fdaf-44c5-8167-06c7589d90f3", | ||
1052 | "name": "Water Quality", | 1054 | "name": "Water Quality", | ||
1053 | "state": "active", | 1055 | "state": "active", | ||
1054 | "vocabulary_id": null | 1056 | "vocabulary_id": null | ||
1055 | }, | 1057 | }, | ||
1056 | { | 1058 | { | ||
1057 | "display_name": "Water temperature", | 1059 | "display_name": "Water temperature", | ||
1058 | "id": "0770347d-73eb-4f60-a661-50199f7049c3", | 1060 | "id": "0770347d-73eb-4f60-a661-50199f7049c3", | ||
1059 | "name": "Water temperature", | 1061 | "name": "Water temperature", | ||
1060 | "state": "active", | 1062 | "state": "active", | ||
1061 | "vocabulary_id": null | 1063 | "vocabulary_id": null | ||
1062 | } | 1064 | } | ||
1063 | ], | 1065 | ], | ||
1064 | "title": "Lake Windermere Ambassadors Annual Water Monitoring | 1066 | "title": "Lake Windermere Ambassadors Annual Water Monitoring | ||
1065 | Reports", | 1067 | Reports", | ||
1066 | "type": "dataset", | 1068 | "type": "dataset", | ||
1067 | "url": null, | 1069 | "url": null, | ||
1068 | "version": null | 1070 | "version": null | ||
1069 | } | 1071 | } |